[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56907.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:295 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->95 PF10544 * T5orf172 6.8e-17 32.0 75/84  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56907.1 GT:GENE BAD56907.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2242127..2243014 GB:FROM 2242127 GB:TO 2243014 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56907.1 LENGTH 295 SQ:AASEQ MHTPSRRGVVYVLMNRAMPGYMKIGKTIKTSDERARQLSGATGVPEDFEIVFDIVVSDVDQVEKLAHKKLDYARTNKRREFFRVDIRAAIQTVTEIASRFPVAEADSISREILPQMETRMRRWLRRDIISVEFVQYSDLCILRVTEQPNLRVSYARSIAFNLEVLGGGFDEDGDGFLFSPYRRSIDENVKIFAEELDAYSMAMVDIPLLSPEATRYIVDGYEAGDVDAMRPDECVIRELWLEGWTIDVGANTSVASDLRLLDRSIKHGITIAGDRQNGWPQSKFYFSKDSDNEEQ GT:EXON 1|1-295:0| SEG 162->178|levlgggfdedgdgflf| HM:PFM:NREP 1 HM:PFM:REP 18->95|PF10544|6.8e-17|32.0|75/84|T5orf172| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----------------------------------------------------1--1--------1-----------------------------------------------1----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------1-------------1------------------------------------------1------------------------------------------------------------1---------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 286-295| PSIPRED ccccccccEEEEEEEcccccEEEEEEccccHHHHHHHHcccccccccEEEEEEEEcccHHHHHHHHHHHHHccccccccEEEEccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEccEEEEEEcccccEEEEEEEEEEEEEEEEEcccccccccEEEcHHHHccccHHHHHHHHHcHHEEEEEEEEcccccccEEEEcccccccccccccHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHccEEEEEccccccccccEEEccccccccc //