[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56908.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->103 PF02796 * HTH_7 0.00014 28.0 25/45  
:HMM:PFM   26->59 PF01527 * Transposase_8 9.3e-05 32.4 34/76  
:REPEAT 2|29->73|77->121

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56908.1 GT:GENE BAD56908.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2243141..2243521) GB:FROM 2243141 GB:TO 2243521 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56908.1 LENGTH 126 SQ:AASEQ MIAQVDAAPPRRTSNAGGDVRPRRLDRRLSDTTIASIVQGYRGGASTNRLCEQYGLSKGGLLKILREHGVEMRYQPMTEDEIDWAVELYIEGQSLNTVARQLGKAKGSVRKALMAEGVEMRPGTRP GT:EXON 1|1-126:0| NREPEAT 1 REPEAT 2|29->73|77->121| HM:PFM:NREP 2 HM:PFM:REP 79->103|PF02796|0.00014|28.0|25/45|HTH_7| HM:PFM:REP 26->59|PF01527|9.3e-05|32.4|34/76|Transposase_8| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------1----2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 4-25, 123-126| PSIPRED cccccccccccccccccccccHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHcccccccccc //