[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56911.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->43 PF03867 * FTZ 6.6e-05 36.0 25/264  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56911.1 GT:GENE BAD56911.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2245270..2245428) GB:FROM 2245270 GB:TO 2245428 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56911.1 LENGTH 52 SQ:AASEQ MVEEPASHPNTSLLPSLTDKNNEVDYALPPPLATPPVEATTLTRGSAFVNQP GT:EXON 1|1-52:0| HM:PFM:NREP 1 HM:PFM:REP 19->43|PF03867|6.6e-05|36.0|25/264|FTZ| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 50-52| PSIPRED cccccccccccccccccccccccccEEccccccccccccEEEccccEEcccc //