Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56912.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:HMM:PFM   13->43 PF07038 * DUF1324 8.1e-06 41.9 31/59  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56912.1 GT:GENE BAD56912.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2245486..2245704 GB:FROM 2245486 GB:TO 2245704 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56912.1 LENGTH 72 SQ:AASEQ MSRGPDAAATSGMTLTTATGACVALVTFLGAQAKAIGDIDRSFPDGKWPDSQATSFNDASVEGDDKSSWKIA GT:EXON 1|1-72:0| TM:NTM 1 TM:REGION 15->37| HM:PFM:NREP 1 HM:PFM:REP 13->43|PF07038|8.1e-06|41.9|31/59|DUF1324| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 66-67| PSIPRED cccccccccccccEEEccHHHHHHHHHHHccccHHHHccccccccccccccccccccccccccccccccccc //