Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56913.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:HMM:PFM   30->124 PF05940 * NnrS 1.3e-06 13.7 95/379  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56913.1 GT:GENE BAD56913.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2245707..2246141 GB:FROM 2245707 GB:TO 2246141 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56913.1 LENGTH 144 SQ:AASEQ MAEVDPARVRAWELRVRIFGFCLYAVIPTVIGCGLLSTQVAEWAGIGVIQRAAIGYALIAQVVAIAVSWRTPPAGASLVVVRMLFFSSYAALAASAALLARKDDWELLTVPIFACMIIMLHAVYERCTQRFEAFGTGTRSDGDG GT:EXON 1|1-144:0| TM:NTM 4 TM:REGION 17->39| TM:REGION 45->67| TM:REGION 77->99| TM:REGION 106->128| SEG 87->100|ssyaalaasaalla| HM:PFM:NREP 1 HM:PFM:REP 30->124|PF05940|1.3e-06|13.7|95/379|NnrS| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 136-137, 139-144| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //