[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56914.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->28 PF10295 * DUF2406 0.00026 45.0 20/69  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56914.1 GT:GENE BAD56914.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2246472..2246744 GB:FROM 2246472 GB:TO 2246744 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56914.1 LENGTH 90 SQ:AASEQ MQPERVSSGRRFKSCQPDSENPFRPRSEGVFQLLVEADHSTHLTKNLGFPVPRARTSGHRAMRPGERPGDGLLSTVPRKRIDRCSDNPLT GT:EXON 1|1-90:0| HM:PFM:NREP 1 HM:PFM:REP 7->28|PF10295|0.00026|45.0|20/69|DUF2406| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-24, 57-68, 87-90| PSIPRED ccccccccccccccccccccccccccHHHHHHHHHHccccccHHcccccccccccccccccccccccccccHHHHHcHHHHHHccccccc //