[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56918.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:96 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->69 PF10099 * RskA 0.00021 32.1 53/175  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56918.1 GT:GENE BAD56918.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2248984..2249274 GB:FROM 2248984 GB:TO 2249274 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56918.1 LENGTH 96 SQ:AASEQ MPASLGGVRWWKAIGLAGAAGVVATGVLVVRGERRRRAYTPDQVREQLHVRYAQVVAAESAETTPAAAVPGPRAWVGRRMARGRRLAERIAKRRGK GT:EXON 1|1-96:0| TM:NTM 1 TM:REGION 11->32| SEG 13->37|aiglagaagvvatgvlvvrgerrrr| SEG 56->70|vaaesaettpaaavp| SEG 73->89|rawvgrrmargrrlaer| HM:PFM:NREP 1 HM:PFM:REP 8->69|PF10099|0.00021|32.1|53/175|RskA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 94-96| PSIPRED ccccccHHHHHHHHHcccHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccc //