[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56919.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   24->90 PF09579 * Spore_YtfJ 2.9e-12 31.3 67/83  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56919.1 GT:GENE BAD56919.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2249293..2249631) GB:FROM 2249293 GB:TO 2249631 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56919.1 LENGTH 112 SQ:AASEQ MKVEDILAAAKDTMTVRRVYAEPVERDGTIVIAAAVVSGGGGAGAGVKDGEEGSGGGFGLNAKPAGAYVIRDGRVSWRPAVDVNRLIAVAGAVVITGMLVGARIATAAVRQG GT:EXON 1|1-112:0| SEG 33->59|aaavvsggggagagvkdgeegsgggfg| HM:PFM:NREP 1 HM:PFM:REP 24->90|PF09579|2.9e-12|31.3|67/83|Spore_YtfJ| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 47-54| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccccccccccccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //