[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56924.1
DDBJ      :             putative monooxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  84/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:396 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   114->184 3ef6A PDBj 3e-04 36.6 %
:BLT:PDB   274->353 3gmcA PDBj 2e-07 35.0 %
:RPS:PDB   35->356 3c96A PDBj 3e-21 22.1 %
:RPS:SCOP  116->356 3c96A1  c.3.1.2 * 4e-13 16.2 %
:HMM:SCOP  13->380 1k0iA1 c.3.1.2 * 1.5e-44 38.1 %
:RPS:PFM   35->326 PF01494 * FAD_binding_3 6e-13 32.8 %
:HMM:PFM   16->326 PF01494 * FAD_binding_3 8.8e-27 24.4 307/356  
:BLT:SWISS 35->362 Y1260_MYCTU 1e-26 31.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56924.1 GT:GENE BAD56924.1 GT:PRODUCT putative monooxygenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2251558..2252748) GB:FROM 2251558 GB:TO 2252748 GB:DIRECTION - GB:PRODUCT putative monooxygenase GB:PROTEIN_ID BAD56924.1 LENGTH 396 SQ:AASEQ MTDHHPTHHRDARQRRVIVIGAGIAGLATALRLHRDGWDVLVVERAPARRSSGYLVNLHGPGYDAVERLGLVPALAARDIGFFRSILVDADGREKFTVPSEVAQAAVGTRALTIFRGDLETVLYEAVADTVEIRFATVPHAVTQDTAGVDVALSDGTRIRADLLVGADGVRSRTRALVFGDDPGHLRDLRHMVAAFPLPEPPAGIPEGAGTTYIGPRRTAAVMNLGPHRSATFFTYRCDDTAAEYARGPERALTAAFGDLGGATAQALAQVTDTAYFDAATQVTLDGLHRGRVVLVGDSAWCVTVFAGYGAALAIDGADRLGAALSRHGDIPTALAAWEAELGPEIHKRQALARRGVSRFAPPTRAHVMAGELALRAIQLPGIRALVRRSIQRANN GT:EXON 1|1-396:0| BL:SWS:NREP 1 BL:SWS:REP 35->362|Y1260_MYCTU|1e-26|31.2|321/372| SEG 15->33|rrvivigagiaglatalrl| SEG 195->210|afplpeppagipegag| BL:PDB:NREP 2 BL:PDB:REP 114->184|3ef6A|3e-04|36.6|71/400| BL:PDB:REP 274->353|3gmcA|2e-07|35.0|80/369| RP:PDB:NREP 1 RP:PDB:REP 35->356|3c96A|3e-21|22.1|321/381| RP:PFM:NREP 1 RP:PFM:REP 35->326|PF01494|6e-13|32.8|287/338|FAD_binding_3| HM:PFM:NREP 1 HM:PFM:REP 16->326|PF01494|8.8e-27|24.4|307/356|FAD_binding_3| GO:PFM:NREP 2 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF01494|IPR002938| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01494|IPR002938| RP:SCP:NREP 1 RP:SCP:REP 116->356|3c96A1|4e-13|16.2|228/269|c.3.1.2| HM:SCP:REP 13->380|1k0iA1|1.5e-44|38.1|260/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 187 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- ----3---------32222-2---6422222412122-12-1---11--21---1--1--22--513-71------------1----------------------2--------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1111---------------------1-11--11------1----1-11-111---1------1------------------------------------------------2---22--------1----------------1-1----------------1--------------------1-------------------------------2---------------------------------------------------------------------------1-----------------------------------1-----------------------------------------------------------1----------------------1------------1-1----11111-1-11-1-----------------1-1-------------------------------------------------------------------- ---------------2-311-1-2323------111----------212233532-112--------------------------------1----------1----------------------------------------------------------------------------3---------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 356 STR:RPRED 89.9 SQ:SECSTR #################################HTTccEEEEEEccccccccccEEEEcHHHHHHHHHTTcHHHHHHHcEEEcEEEEEcTTccEEEEEEcGGGGTcEcccEEEEEHHHHHHHHHHHHHHTTcEEEcEEEEEEEEETTEEEEEEEETEEEEEcEEEEcccTTcHHHHHHcTTccccEEEEEEEEEEEEEEcccTTccEEEEEHHHTTTcEEEEEEEEEEHHHHccccccccTTccccHHHHHHHHTTcccTTccHHHHHHTccEEEEEEEEEcccccccccTTEEEcTHHHHcccccTTcTHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccEHTTccccccccccHHHHHHHHHH####### DISOP:02AL 1-12, 394-396| PSIPRED ccccccccHHHccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccccEEEEcHHHHHHHHHcccHHHHHHccccEEEEEEEEccccEEEEEccccccccccccEEEEEHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEccccEEEEEEEEEcccccHHHHHHHccccccccccEEEEEEEEEEcccccccccccEEEEEccccEEEEEEcccccEEEEEEEEccccccccccccHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHcccccccccEEEEEccHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccc //