[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56925.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->29 PF03702 * UPF0075 0.00065 52.4 21/364  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56925.1 GT:GENE BAD56925.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2252860..2253078) GB:FROM 2252860 GB:TO 2253078 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56925.1 LENGTH 72 SQ:AASEQ MGPQLPARDVTVVADWRNLDTAATGFGEPGSYLAGQRLPPAITLLPTGPARVQLTLRTDKPNIPASLDVFAS GT:EXON 1|1-72:0| HM:PFM:NREP 1 HM:PFM:REP 9->29|PF03702|0.00065|52.4|21/364|UPF0075| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccEEEEEEEEcccccccccccccccccccccccccEEEEEccccEEEEEEEcccccccccEEEEEc //