[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56926.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56926.1 GT:GENE BAD56926.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2253280..2253498 GB:FROM 2253280 GB:TO 2253498 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56926.1 LENGTH 72 SQ:AASEQ MSMSMSRTFATVAVAAVIASTAGFAPAVAAPPAVAVADTGSAAGSSEYARGLVELVVCLFKGELVGSRAPLC GT:EXON 1|1-72:0| TM:NTM 2 TM:REGION 12->34| TM:REGION 50->72| SEG 8->37|tfatvavaaviastagfapavaappavava| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccHHHHHHHHHHHHHHHHHccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHccccccccccc //