[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56927.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->50 PF04956 * TrbC 0.0007 27.1 48/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56927.1 GT:GENE BAD56927.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2253524..2253745 GB:FROM 2253524 GB:TO 2253745 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56927.1 LENGTH 73 SQ:AASEQ MSKLITAVAVAAALLAAPAAASAAPADAPTGSASSGSSDLLIYVIRCLPIGPLVALSSGMPDDGIVDPDPCAV GT:EXON 1|1-73:0| TM:NTM 2 TM:REGION 2->23| TM:REGION 40->62| SEG 6->39|tavavaaallaapaaasaapadaptgsassgssd| HM:PFM:NREP 1 HM:PFM:REP 3->50|PF04956|0.0007|27.1|48/100|TrbC| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 24-35| PSIPRED ccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccHHHHccccccccccccccccc //