[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56928.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:358 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->217 2p5yA PDBj 2e-05 31.0 %
:RPS:PDB   1->325 1a9zA PDBj 2e-13 15.9 %
:RPS:SCOP  3->307 1sb8A  c.2.1.2 * 2e-19 20.5 %
:HMM:SCOP  2->320 1eq2A_ c.2.1.2 * 2.3e-50 32.7 %
:RPS:PFM   4->109 PF01073 * 3Beta_HSD 1e-09 36.9 %
:HMM:PFM   3->235 PF01370 * Epimerase 2.8e-32 32.2 227/238  
:BLT:SWISS 1->109 Y2073_MYCBO 1e-09 39.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56928.1 GT:GENE BAD56928.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2253977..2255053 GB:FROM 2253977 GB:TO 2255053 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56928.1 LENGTH 358 SQ:AASEQ MKVVVVGASGNIGSALVRVLLAAGEEVVGLCRRPPGPGTFDAVRWVRCDLADPAAVDTLRATFADADAVVHLAWAIHPRVGEPPMMRTNLTGTDRVLAAVADRGVPHLVCASSAAAYRPAPRWERVDERWPVGGVPGSAYSVGKAVLERQLVRFVAAHPGTRVVRFRPCAVVQGAAGAEIADWAVSRWLPRTVIGRRLLPVPAWPGLRLQFVHAEDVAAAIHLALRAQAAGAYNLAAEPVLRAAALSRQLGGFRVPVPRAVLTAAAWPAWRLGLQPLHPGWLRLADRAPLLDTTAARHDLGWRPRHDGVAVCAELVDALASKRCGPTPVLSPGRPPVRITRPTHQSQSPRKALSDSAF GT:EXON 1|1-358:0| BL:SWS:NREP 1 BL:SWS:REP 1->109|Y2073_MYCBO|1e-09|39.2|97/854| SEG 111->122|assaaayrpapr| SEG 218->237|aaaihlalraqaagaynlaa| BL:PDB:NREP 1 BL:PDB:REP 1->217|2p5yA|2e-05|31.0|210/311| RP:PDB:NREP 1 RP:PDB:REP 1->325|1a9zA|2e-13|15.9|321/338| RP:PFM:NREP 1 RP:PFM:REP 4->109|PF01073|1e-09|36.9|103/261|3Beta_HSD| HM:PFM:NREP 1 HM:PFM:REP 3->235|PF01370|2.8e-32|32.2|227/238|Epimerase| GO:PFM:NREP 2 GO:PFM GO:0003854|"GO:3-beta-hydroxy-delta5-steroid dehydrogenase activity"|PF01073|IPR002225| GO:PFM GO:0006694|"GO:steroid biosynthetic process"|PF01073|IPR002225| RP:SCP:NREP 1 RP:SCP:REP 3->307|1sb8A|2e-19|20.5|283/341|c.2.1.2| HM:SCP:REP 2->320|1eq2A_|2.3e-50|32.7|300/307|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 49 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- -------1-------------1----------12222--2-11111---22-111-1-------221-11------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------111111-------------------------------------------------------------1--------------------------1----------------------------11------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 335 STR:RPRED 93.6 SQ:SECSTR cEEEEETTTcHHHHHHHHHHHHTTcEEEEEEcccccHHHHTcccEEEEccTTcHHHHHHHHHHTTccEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHTccEEEEEEEGGGGcccccccccTTccccccccccHHHHHHHHHHHHHHHHHHHcTTcEEEEEcEEEccTTcccccccccccccHHHHHHHHHccTTccccEEEEcccccccccccEEcEEEHHHHHHHHHHHHHHHTTccEEEEEEEcccccEEHHHHHHHHHHHHTccccEEEEcccTTcccccccccHHHHHHHcccccccHHHHHHHHHHHHHHcTTcHHHHHHcGTT####################### DISOP:02AL 336-358| PSIPRED cEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccccccccEEEEEEcccHHHHHHHHHHHccccEEEEccEEccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHccccEEEEcccccEEEEEEHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHccccEEEcHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHcccccc //