[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56930.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  349/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.78.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->202 3fmsA PDBj 4e-12 27.7 %
:RPS:PDB   1->211 3c7jA PDBj 5e-26 20.8 %
:RPS:SCOP  11->78 1sfuA  a.4.5.19 * 7e-10 12.1 %
:RPS:SCOP  50->213 1e2xA2  a.78.1.1 * 1e-18 14.5 %
:HMM:SCOP  2->94 1v4rA1 a.4.5.6 * 4.6e-12 32.6 %
:RPS:PFM   13->73 PF00392 * GntR 6e-06 48.3 %
:RPS:PFM   109->203 PF07729 * FCD 6e-09 42.6 %
:HMM:PFM   83->203 PF07729 * FCD 5.6e-24 35.0 120/125  
:HMM:PFM   15->73 PF00392 * GntR 9.3e-14 45.8 59/64  
:BLT:SWISS 16->213 YIN1_STRAM 9e-16 32.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56930.1 GT:GENE BAD56930.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2256805..2257449 GB:FROM 2256805 GB:TO 2257449 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56930.1 LENGTH 214 SQ:AASEQ MTTSKTSAASAPELAYEWLKNTILTLPRDEEMFLSEAQVAAASGTSRTPVREALLRLEAEGFIRRVPHKGAYIPALTDKDVDDVMQARRVVEEWSIAQVAPNPGQVPDRLRELLAAQDADTDPVEFIAHDLEFHTTVIRAAGNQVMHEFYRSLRDRQMRMGVRIMLSDERRKKQVLVEHGAIVDALAAGDTEAAIHAVREHLDTTLCSLKQPRF GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 16->213|YIN1_STRAM|9e-16|32.5|194/236| BL:PDB:NREP 1 BL:PDB:REP 34->202|3fmsA|4e-12|27.7|159/206| RP:PDB:NREP 1 RP:PDB:REP 1->211|3c7jA|5e-26|20.8|207/232| RP:PFM:NREP 2 RP:PFM:REP 13->73|PF00392|6e-06|48.3|60/64|GntR| RP:PFM:REP 109->203|PF07729|6e-09|42.6|94/125|FCD| HM:PFM:NREP 2 HM:PFM:REP 83->203|PF07729|5.6e-24|35.0|120/125|FCD| HM:PFM:REP 15->73|PF00392|9.3e-14|45.8|59/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 2 RP:SCP:REP 11->78|1sfuA|7e-10|12.1|66/70|a.4.5.19| RP:SCP:REP 50->213|1e2xA2|1e-18|14.5|145/149|a.78.1.1| HM:SCP:REP 2->94|1v4rA1|4.6e-12|32.6|89/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 992 OP:NHOMOORG 360 OP:PATTERN ------1-11-11111-1--------------------------------------------1----- ---13111223---22211-11--29-----1111156B7-1-1741--34-978211----5-13A943------------5--------------------1---------------------------------1142----2-----------------------1---------------111---4-211111--1-111--14-22-111----121-------14------------------------11----------------------------------------------------------------23211----------33---1--212---2312222211-1121112-1----2112-----11766--42131-33333333327-1161173676--C88655583A8686---4263342534111111114111-2----------------------------------3--2C97A5443453111166B811111153D79A8122215432294D-C4222----1-----------111--3----1--1--1-2121111-1-------2-----------------------------1--2111-1122221112222221121-----1---------121--1---------------1---2---------222222---4-424344443243232-----------------------------------2141---------------1222212---2222323422344441231-------------211111-1122-----------------------------------------------------------------1-111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 98.6 SQ:SECSTR HccccccGGGHHHHHHHHHHHHHHTccccTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTTEEEEcccHHHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHH### DISOP:02AL 1-15| PSIPRED ccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHcccEEEEcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcc //