[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56932.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  44/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.177.1
:232 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  123->208 1nkqA  d.177.1.1 * 1e-04 28.6 %
:HMM:SCOP  26->208 1nkqA_ d.177.1.1 * 2.4e-05 23.3 %
:RPS:PFM   30->220 PF11010 * DUF2848 5e-31 46.8 %
:HMM:PFM   30->220 PF11010 * DUF2848 3.8e-71 46.6 189/194  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56932.1 GT:GENE BAD56932.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2258280..2258978 GB:FROM 2258280 GB:TO 2258978 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56932.1 LENGTH 232 SQ:AASEQ MTETITAALSCTVLDSGETLSFDGARAIVAGYTGRDEAAVRHHIDELAAIGVAPPESVPMLYPVSTATVTTAATTPVPSADTSGEVEPVLLRHRGRYFLGVGSDHTDRALETIDIGESKRACAKPIGPHVVEVADWSRFDWDACRARSWVDGKLYQDGTLAALRTPTDLLGVVADRLGDDGGDFVCFAGTLPLLDGEFTPGTRWDLELLLPDGRALTHTYTTLEGARDAHRS GT:EXON 1|1-232:0| SEG 63->83|pvstatvttaattpvpsadts| RP:PFM:NREP 1 RP:PFM:REP 30->220|PF11010|5e-31|46.8|188/193|DUF2848| HM:PFM:NREP 1 HM:PFM:REP 30->220|PF11010|3.8e-71|46.6|189/194|DUF2848| RP:SCP:NREP 1 RP:SCP:REP 123->208|1nkqA|1e-04|28.6|84/247|d.177.1.1| HM:SCP:REP 26->208|1nkqA_|2.4e-05|23.3|180/257|d.177.1.1|1/1|FAH| OP:NHOMO 51 OP:NHOMOORG 44 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-21----1----11-111-----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111--------------1--1------------------11---1--------1----------------------------------------------------1--1122221-----111-------2---211--11------1-----------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 228-232| PSIPRED ccEEEEEEEEEEEcccccEEEEEHHEEEEEccccccHHHHHHHHHHHHHHcccccccccEEEcccHHHccccccEEccccccccEEEEEEEccccEEEEEEEccccHHHHHHcccEEEcccccccccHHHEEHHHcccccccEEEEEEEEccEEEEccccHHcccHHHHHHHHccccccccccEEEEEccEEccccccccccEEEEEEEccccHHHHHHHHHHHccHHHccc //