[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56933.1
DDBJ      :             putative 4-hydroxyphenylacetate 3-hydroxylase
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  142/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.29.3e.6.1
:484 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->471 2yyjA PDBj 7e-74 35.9 %
:RPS:PDB   16->133 2azqA PDBj 8e-04 11.9 %
:RPS:PDB   176->398 2ebaA PDBj 2e-10 17.7 %
:RPS:SCOP  1->268 1u8vA2  e.6.1.1 * 7e-24 25.1 %
:RPS:SCOP  295->467 1u8vA1  a.29.3.1 * 2e-18 21.1 %
:HMM:SCOP  1->268 1u8vA2 e.6.1.1 * 2.7e-75 41.2 %
:HMM:SCOP  259->479 1u8vA1 a.29.3.1 * 2e-58 38.3 %
:RPS:PFM   3->268 PF11794 * HpaB_N 2e-67 47.9 %
:RPS:PFM   277->466 PF03241 * HpaB 6e-39 43.1 %
:HMM:PFM   3->268 PF11794 * HpaB_N 6.5e-94 49.0 261/264  
:HMM:PFM   276->476 PF03241 * HpaB 1.5e-67 39.7 199/205  
:BLT:SWISS 3->450 HPAB_KLEOX 2e-74 37.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56933.1 GT:GENE BAD56933.1 GT:PRODUCT putative 4-hydroxyphenylacetate 3-hydroxylase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2258962..2260416 GB:FROM 2258962 GB:TO 2260416 GB:DIRECTION + GB:PRODUCT putative 4-hydroxyphenylacetate 3-hydroxylase GB:PROTEIN_ID BAD56933.1 LENGTH 484 SQ:AASEQ MRTGAEYLSSLNDGRVVLVDGEKVDDVTTHPAFAPVAQTIAELFDLAADPANGMQYTAPETGGPANRVFGIPRSQEELRARREAIQTWAQHTHGWVGRSPDHVGTFLASFAAHPEVFAEGTRDFSANVTAFHRRLLADNLYVSYAIIPPQVSRATTASGWEGEFLQVGVVRETEEGLIVRGSQMLATGAAIADEILVSCIKPLGPDDQDFAVSFVVPANAEGLKLYCRRPYAPAATSSFDYPLTSRYDEPDALVVFDDVLIPWDRVFVDRDIAGVRRQFFDTGAHALGNWQAQIRFATKLRFIAGVARRVTQVNGVDKIPSVQEKLGELAALVAGVESAVLAAEYTATPDEAGQWVPGKRALYGSMGLQSEIYPRVLSILRDLVGGGVLQLPSSVADLTSPLTSGDVTHYVQSPGVPSEDRIKLFKLAWDIIGSEFAGRHQQYELFYAGAPFVVKGAYTYRNYGYEEPLRDVEQFLAAYKSETA GT:EXON 1|1-484:0| BL:SWS:NREP 1 BL:SWS:REP 3->450|HPAB_KLEOX|2e-74|37.8|439/520| BL:PDB:NREP 1 BL:PDB:REP 2->471|2yyjA|7e-74|35.9|460/476| RP:PDB:NREP 2 RP:PDB:REP 16->133|2azqA|8e-04|11.9|118/309| RP:PDB:REP 176->398|2ebaA|2e-10|17.7|198/380| RP:PFM:NREP 2 RP:PFM:REP 3->268|PF11794|2e-67|47.9|263/265|HpaB_N| RP:PFM:REP 277->466|PF03241|6e-39|43.1|188/204|HpaB| HM:PFM:NREP 2 HM:PFM:REP 3->268|PF11794|6.5e-94|49.0|261/264|HpaB_N| HM:PFM:REP 276->476|PF03241|1.5e-67|39.7|199/205|HpaB| GO:PFM:NREP 2 GO:PFM GO:0010124|"GO:phenylacetate catabolic process"|PF03241|IPR004925| GO:PFM GO:0016712|"GO:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen"|PF03241|IPR004925| RP:SCP:NREP 2 RP:SCP:REP 1->268|1u8vA2|7e-24|25.1|267/275|e.6.1.1| RP:SCP:REP 295->467|1u8vA1|2e-18|21.1|171/215|a.29.3.1| HM:SCP:REP 1->268|1u8vA2|2.7e-75|41.2|267/0|e.6.1.1|1/1|Acyl-CoA dehydrogenase NM domain-like| HM:SCP:REP 259->479|1u8vA1|2e-58|38.3|206/0|a.29.3.1|1/1|Acyl-CoA dehydrogenase C-terminal domain-like| OP:NHOMO 224 OP:NHOMOORG 162 OP:PATTERN ---1--4333333333--1-1113------------------------------------------11 --------------------------------11113165--1--1------112--1--11--------------------1-----------11----------------------------------------11111----5-------------------------------------11112---1-1------2-11--1--11---1-1--2211--------1--------------------------------11-------------------------------------------------------------1-----------111--------------1---2---2---------------------------1-------------------------1-1-------1--1--12----------------------------------------------------------------------1111--1111----1111-11---21--1---11---1-------1--------------------5-1---------------1----------11---------------------------------1----------------------1----------------1------------1--1-1---1----111-1111-1--34-1111111111111111111-2--1---11111111111--------------------------------1------------2222-1------------------------------------------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 469 STR:RPRED 96.9 SQ:SECSTR cccHHHHHHHHHHccHHHHHHTTHHHHHHHHHHHHHHHTTcccccccccccccccTTccEEEcEEEcccccccccEEEEEEEEEcccccccTTcEEEEcccTTccccTTcTTccTTTTEEEEEccTTcEEEEEHHHHHTccEEEccHHHHHHTcccEEEEcccccccEEEEETTTEEEEEEEEEEEETTTTccEEEEEEEcEEEEEccccEEEEEEETTcTTEEccEEEcccccccccccEcccccTTccEEEEEEEEEEEEGGGccTTcccTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGGGcTTccHHHHHcTTcHHHHHHHTccccccHHHHHHHHHHHHHHHTcHHHHHHHHHHHHTTccH##HHHHHHHHHHcccHHHHH############# DISOP:02AL 1-3, 481-484| PSIPRED cccHHHHHHHHHcccEEEEccEEEccccccccHHHHHHHHHHHHHHHHccccccEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHHccEEEEEEEEcccccccccccccccccEEEEEEEEccccEEEEccEEEEccHHHHcEEEEEEccccccccccEEEEEEEEcccccEEEEEEccccccccccccccccccccccEEEEEEccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEccccHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccc //