[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56934.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:115 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   11->108 3ebrA PDBj 5e-06 14.0 %
:RPS:SCOP  20->115 1y9qA2  b.82.1.15 * 7e-08 14.7 %
:HMM:SCOP  3->114 1rc6A_ b.82.1.11 * 1.8e-12 25.5 %
:RPS:PFM   43->102 PF02311 * AraC_binding 6e-05 41.8 %
:HMM:PFM   44->104 PF07883 * Cupin_2 1.9e-07 33.3 57/71  
:HMM:PFM   11->45 PF09413 * DUF2007 0.00037 37.1 35/68  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56934.1 GT:GENE BAD56934.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2260447..2260794 GB:FROM 2260447 GB:TO 2260794 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56934.1 LENGTH 115 SQ:AASEQ MAKPEFEFFPVTDVEYTVCPGGDPAITERILARDPDGNVATRILRYEPGADSTPMGVQKHDFWEEVYILEGSFTDLTLGQTFTAGMYACRPPGMPHGPWRTDEGVVTFEVRYHSR GT:EXON 1|1-115:0| RP:PDB:NREP 1 RP:PDB:REP 11->108|3ebrA|5e-06|14.0|93/151| RP:PFM:NREP 1 RP:PFM:REP 43->102|PF02311|6e-05|41.8|55/130|AraC_binding| HM:PFM:NREP 2 HM:PFM:REP 44->104|PF07883|1.9e-07|33.3|57/71|Cupin_2| HM:PFM:REP 11->45|PF09413|0.00037|37.1|35/68|DUF2007| GO:PFM:NREP 1 GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02311|IPR003313| RP:SCP:NREP 1 RP:SCP:REP 20->115|1y9qA2|7e-08|14.7|95/99|b.82.1.15| HM:SCP:REP 3->114|1rc6A_|1.8e-12|25.5|110/253|b.82.1.11|1/1|RmlC-like cupins| OP:NHOMO 26 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-1-----1-------1-------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1------------------------------------------------------------------2222----------------1---11--------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------1-1111------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 100.0 SQ:SECSTR HHccEEEEEEccGGGcccEcTTTccccEEEEEEETTTTEEEEEEEEEEccccccEEcEEEcccEEEEEEEccEEETTccccccTTcEEEEcccEEEcEEEcccccccEEEEEccG DISOP:02AL 1-3| PSIPRED ccccccEEEEEEccccEEccccccHHHHHHHHccccccEEEEEEEEcccccccccccccccccEEEEEEEEEEEEccccEEcccccEEEcccccccccEEccccEEEEEEEEEcc //