[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56939.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  150/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   74->277 1s9cJ PDBj 1e-18 32.6 %
:RPS:PDB   14->259 2bi0A PDBj 7e-21 15.0 %
:RPS:SCOP  50->146 1pn2A1  d.38.1.4 * 6e-16 22.1 %
:RPS:SCOP  163->281 1pn2A2  d.38.1.4 * 5e-13 30.1 %
:HMM:SCOP  11->158 1s9cA2 d.38.1.4 * 5.8e-25 33.6 %
:HMM:SCOP  159->282 1s9cA1 d.38.1.4 * 1.4e-20 28.2 %
:RPS:PFM   182->259 PF01575 * MaoC_dehydratas 4e-11 41.0 %
:HMM:PFM   20->106 PF01575 * MaoC_dehydratas 1.1e-05 25.3 87/123  
:HMM:PFM   164->270 PF01575 * MaoC_dehydratas 2.8e-28 32.1 106/123  
:BLT:SWISS 20->103 Y1896_PROAC 8e-07 34.9 %
:BLT:SWISS 78->281 MFEB_DICDI 3e-19 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56939.1 GT:GENE BAD56939.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2264559..2265413) GB:FROM 2264559 GB:TO 2265413 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56939.1 LENGTH 284 SQ:AASEQ MNPDLAFAEENLNVWTEDFPFTVERDRIADYAAATNDPIPAHRRGDVASPVFAIVPVFERMIEPAVDVVPLSIFGRGVHGEQDFHFHRPIRPGDTLVARARMTGYEGLPKGTRAVVHVECRDTAGELVNEQYVTMFFRGADASNGRSVGELGPSHKLPDGIRDREPVAKVAQHIDADQTFRYAPASGDPVPLHLDEQVAKDAGLPGIIAHGLCTMAFASWAVLTEVGDADVTRLKRLAVRFSKMVFPSDDLETRIWRTGAATYAFETVRGTDVVLGDGLAVFTD GT:EXON 1|1-284:0| BL:SWS:NREP 2 BL:SWS:REP 20->103|Y1896_PROAC|8e-07|34.9|83/142| BL:SWS:REP 78->281|MFEB_DICDI|3e-19|30.8|201/294| BL:PDB:NREP 1 BL:PDB:REP 74->277|1s9cJ|1e-18|32.6|187/255| RP:PDB:NREP 1 RP:PDB:REP 14->259|2bi0A|7e-21|15.0|240/327| RP:PFM:NREP 1 RP:PFM:REP 182->259|PF01575|4e-11|41.0|78/116|MaoC_dehydratas| HM:PFM:NREP 2 HM:PFM:REP 20->106|PF01575|1.1e-05|25.3|87/123|MaoC_dehydratas| HM:PFM:REP 164->270|PF01575|2.8e-28|32.1|106/123|MaoC_dehydratas| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01575|IPR002539| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01575|IPR002539| RP:SCP:NREP 2 RP:SCP:REP 50->146|1pn2A1|6e-16|22.1|95/148|d.38.1.4| RP:SCP:REP 163->281|1pn2A2|5e-13|30.1|113/124|d.38.1.4| HM:SCP:REP 11->158|1s9cA2|5.8e-25|33.6|143/0|d.38.1.4|1/2|Thioesterase/thiol ester dehydrase-isomerase| HM:SCP:REP 159->282|1s9cA1|1.4e-20|28.2|124/0|d.38.1.4|2/2|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 340 OP:NHOMOORG 225 OP:PATTERN -------------------------------------------------------------------- ----1---------31122-22--11222221322223441212-11---1-------1111-----2112------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--2-------211---21211----------------------2-1------1---------------------------1-----1-------------------------------------1--2----1----------------1----11--------111-1----------------------1---2-1---------------------1-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------- ----111-----112-21-2222122122222211122222221222112222323112222---1111111---111111111-1---22222221111232332-1--2111113--1--11121113E1-1131-1-1111-1-1-11--1-2111121111111112-111-1-------11131111--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 95.4 SQ:SECSTR #############EEcccccEEccHHHHHHHHHHHccccHHHHcHHHHHHHcccccccHHHHHHHHHHHHTTTTTTEEEEEEcEEccccccTTcEEEEEEEEEEEEEccccTTcccEEEEEEEEccEEEEEEEEEEEccTTcccccccccccTTHHHHHHcccccccGGGTTcEEcccHHHHHHHTTcccGGGTcTTTTcTcTTccccccHHHHHHHHHHHHHHHHcTTccEEEEEEEEEEcccccTTcEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEc DISOP:02AL 140-159| PSIPRED cccEEEEEEcccccccccccEEEcHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccHHHEEEEEEEEEEEEEcccccEEEEEEEEEEEEEcccccEEEEEEEEEEccccEEEEEEEEEEEEEcccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHccccEEEccHHHHHHcccccEEEHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccccEEEEEEEEEccEEEEEEEEEccEEEEEccEEEEcc //