[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56940.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.129.3
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   77->138 3d4oD PDBj 9e-04 35.5 %
:RPS:PDB   1->132 2b79A PDBj 8e-10 10.3 %
:RPS:SCOP  2->145 2rerA1  d.129.3.6 * 3e-11 9.7 %
:HMM:SCOP  1->145 1z94A1 d.129.3.5 * 2.2e-20 23.9 %
:HMM:PFM   1->132 PF10604 * Polyketide_cyc2 8.4e-21 23.8 126/139  
:BLT:SWISS 1->98 Y1573_MYCBO 2e-13 32.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56940.1 GT:GENE BAD56940.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2265418..2265858) GB:FROM 2265418 GB:TO 2265858 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56940.1 LENGTH 146 SQ:AASEQ MGHIEETKHLAAEPQAVWAVVSDLASWSSWFTVHDKWLEEPPADLAVGTTLVAKVVMLGMANKIEWTVREVEAPSKLVLTGTGLAGVKVEFAFTLTARDGGSDFHIAGDFEGAMIKGALGKAVEKDAGRQLEDSVGKLEPLATAGV GT:EXON 1|1-146:0| BL:SWS:NREP 1 BL:SWS:REP 1->98|Y1573_MYCBO|2e-13|32.3|96/143| BL:PDB:NREP 1 BL:PDB:REP 77->138|3d4oD|9e-04|35.5|62/279| RP:PDB:NREP 1 RP:PDB:REP 1->132|2b79A|8e-10|10.3|126/142| HM:PFM:NREP 1 HM:PFM:REP 1->132|PF10604|8.4e-21|23.8|126/139|Polyketide_cyc2| RP:SCP:NREP 1 RP:SCP:REP 2->145|2rerA1|3e-11|9.7|144/155|d.129.3.6| HM:SCP:REP 1->145|1z94A1|2.2e-20|23.9|138/0|d.129.3.5|1/1|Bet v1-like| OP:NHOMO 57 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- --------------33322-23112222222232222222--------------------11-----1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 99.3 SQ:SECSTR ccEEEEEEEEcccHHHHHHHHHcGGGGGGTcTTEEEEEEEEcccccTTcEEEEEEEEETTcccEEEEEccccTTTEEEEEEEEETTEEEEEEEEEEEcTTccEEEEEEccccccTTHHHHHHHHTTHHHHHHHHHHHHHHHHHcc# DISOP:02AL 1-6, 145-146| PSIPRED cEEEEEEEEEcccHHHHHHHHccHHHcccHHHHHHccccccccEEccccEEEEEEEEEccccEEEEEEEEEEcccEEEEEccccccEEEEEEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //