[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56952.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  31/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   57->123 3ht1A PDBj 1e-04 31.3 %
:RPS:PDB   21->123 2bnmA PDBj 7e-05 15.5 %
:RPS:SCOP  66->123 1o5uA  b.82.1.8 * 2e-09 22.8 %
:HMM:SCOP  34->123 1lknA_ b.82.1.8 * 6.8e-10 23.0 %
:RPS:PFM   31->123 PF06249 * EutQ 3e-12 46.0 %
:HMM:PFM   32->123 PF06249 * EutQ 1.7e-14 30.7 88/152  
:BLT:SWISS 24->52 AMO_ARATH 2e-04 48.3 %
:BLT:SWISS 40->123 EUTQ_SALTY 2e-08 36.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56952.1 GT:GENE BAD56952.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2278832..2279224 GB:FROM 2278832 GB:TO 2279224 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56952.1 LENGTH 130 SQ:AASEQ MTSPGPTVDTPVAPFRVTSGFWQSLPQMPTTDYPGTSAYIDDVYANPDGSPMSAGYFELRHTDAPLDYHYAYDEMKVVLDGEFRLENLDTGQIETAGPRDAIFFPKGSRIRFTTPARALAFFVGHRSFAP GT:EXON 1|1-130:0| BL:SWS:NREP 2 BL:SWS:REP 24->52|AMO_ARATH|2e-04|48.3|29/100| BL:SWS:REP 40->123|EUTQ_SALTY|2e-08|36.2|80/229| BL:PDB:NREP 1 BL:PDB:REP 57->123|3ht1A|1e-04|31.3|67/142| RP:PDB:NREP 1 RP:PDB:REP 21->123|2bnmA|7e-05|15.5|103/194| RP:PFM:NREP 1 RP:PFM:REP 31->123|PF06249|3e-12|46.0|87/122|EutQ| HM:PFM:NREP 1 HM:PFM:REP 32->123|PF06249|1.7e-14|30.7|88/152|EutQ| RP:SCP:NREP 1 RP:SCP:REP 66->123|1o5uA|2e-09|22.8|57/88|b.82.1.8| HM:SCP:REP 34->123|1lknA_|6.8e-10|23.0|87/89|b.82.1.8|1/1|RmlC-like cupins| OP:NHOMO 39 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ---------------------1---1------1---1-21---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------1-111111-1---------1111111---11--1111--------11-----1----1------11111-------------------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 89.2 SQ:SECSTR #######HccTTccccccccGccEEcccTTccTTEEEEEccccTTcTTcEEEEEEEccccGGGccccccccccEEEEEEEccEEEccTTccEEEEEcTTcEEEEcTTccEEEEcccEEEEEEE####### DISOP:02AL 1-8| PSIPRED ccccccccccccccEEEEEcHHHcccccccccccccEEEEEEEEEccccccEEEEEEEEEcccccEEEEEccccEEEEEccEEEEEEccccEEEEEccccEEEEccccEEEEEEcccEEEEEEEEEcccc //