[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56953.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.24.1
:182 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  68->94 1ehkA  f.24.1.1 * 7e-04 56.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56953.1 GT:GENE BAD56953.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2279229..2279777 GB:FROM 2279229 GB:TO 2279777 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56953.1 LENGTH 182 SQ:AASEQ MSATDITRPVGTVPRWTAGDPAELPVATVATTYVVVATDPAALADARGFADRVTRAQRTPARAGRQPAILVDGTDDRRLTEVLALARVGWRFAVIGTEPGLPRCRAAILAAGAIESEIVTAGPADGGARDLYCAHCRTTSRTDAAVGAETRCAACGVPLTVYHHFSPRLHAYLGYHPHAEEL GT:EXON 1|1-182:0| SEG 26->42|vatvattyvvvatdpaa| RP:SCP:NREP 1 RP:SCP:REP 68->94|1ehkA|7e-04|56.0|25/544|f.24.1.1| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------1---1----------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 180-182| PSIPRED ccccccccccccccccccccccccccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHccHHHcccccEEEEEccccHHHHHHHHHHHEEEEEEEEEccccHHHHHHHHHHHcccHHHHHHccccccccccEEEEEEcccccccccccccccccccccEEEEEEcccHHHHHHHcccccHHcc //