[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56954.1
DDBJ      :             putative oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  255/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1d.15.4
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->312 2piaA PDBj 7e-43 38.3 %
:RPS:PDB   40->235 2bn4B PDBj 3e-21 18.1 %
:RPS:PDB   233->311 1e10A PDBj 4e-17 27.8 %
:RPS:SCOP  2->97 2piaA1  b.43.4.2 * 1e-08 30.2 %
:RPS:SCOP  96->240 1ep1B2  c.25.1.3 * 1e-19 14.1 %
:RPS:SCOP  219->312 2piaA3  d.15.4.2 * 4e-14 42.4 %
:HMM:SCOP  1->98 2piaA1 b.43.4.2 * 2.6e-25 44.9 %
:HMM:SCOP  96->223 1ep3B2 c.25.1.3 * 1.5e-26 40.8 %
:HMM:SCOP  207->312 1e0zA_ d.15.4.1 * 7e-23 36.2 %
:RPS:PFM   111->198 PF00175 * NAD_binding_1 2e-04 34.1 %
:RPS:PFM   231->302 PF00111 * Fer2 2e-04 42.4 %
:HMM:PFM   233->303 PF00111 * Fer2 8.5e-13 27.1 70/77  
:HMM:PFM   8->100 PF00970 * FAD_binding_6 1.4e-10 25.0 92/99  
:HMM:PFM   183->199 PF00175 * NAD_binding_1 2e-05 58.8 17/109  
:HMM:PFM   110->129 PF08030 * NAD_binding_6 6.2e-05 55.0 20/158  
:BLT:SWISS 3->312 POBB_PSEPS 4e-45 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56954.1 GT:GENE BAD56954.1 GT:PRODUCT putative oxidoreductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2279777..2280715 GB:FROM 2279777 GB:TO 2280715 GB:DIRECTION + GB:PRODUCT putative oxidoreductase GB:PROTEIN_ID BAD56954.1 LENGTH 312 SQ:AASEQ MPADLELVVAAARMLCADVRELELRDPAGAPLPAFPPGGHIAVAWGRGLRNSYSLTGPGEAPSRYTISVRLDPAGRGGSRWLHRLPVGARLRVSPPRGDFAPVARARHHLLLAGGIGVTPILSHVRAALRWDRSFRVVYVHRPESAPHAAELAGMCGDRLTRVTSRERFWDAVGPLLRDSPLGTHLYVCGPEPMIEAVRLAADAAGWPGERVHTEAFLPVTAGGAPFTAHLRRRGTTVRVPADAGLLDVLDAHGAGVPSLCRRGVCGECRLPVRAGAIDHRDSYLTDDERAAGDSMMACVSRAAAGHLELDL GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 3->312|POBB_PSEPS|4e-45|40.0|305/319| SEG 27->39|pagaplpafppgg| BL:PDB:NREP 1 BL:PDB:REP 5->312|2piaA|7e-43|38.3|298/321| RP:PDB:NREP 2 RP:PDB:REP 40->235|2bn4B|3e-21|18.1|188/641| RP:PDB:REP 233->311|1e10A|4e-17|27.8|79/128| RP:PFM:NREP 2 RP:PFM:REP 111->198|PF00175|2e-04|34.1|88/107|NAD_binding_1| RP:PFM:REP 231->302|PF00111|2e-04|42.4|66/71|Fer2| HM:PFM:NREP 4 HM:PFM:REP 233->303|PF00111|8.5e-13|27.1|70/77|Fer2| HM:PFM:REP 8->100|PF00970|1.4e-10|25.0|92/99|FAD_binding_6| HM:PFM:REP 183->199|PF00175|2e-05|58.8|17/109|NAD_binding_1| HM:PFM:REP 110->129|PF08030|6.2e-05|55.0|20/158|NAD_binding_6| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00111|IPR001041| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF00111|IPR001041| RP:SCP:NREP 3 RP:SCP:REP 2->97|2piaA1|1e-08|30.2|96/103|b.43.4.2| RP:SCP:REP 96->240|1ep1B2|1e-19|14.1|142/160|c.25.1.3| RP:SCP:REP 219->312|2piaA3|4e-14|42.4|92/98|d.15.4.2| HM:SCP:REP 1->98|2piaA1|2.6e-25|44.9|98/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 96->223|1ep3B2|1.5e-26|40.8|120/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| HM:SCP:REP 207->312|1e0zA_|7e-23|36.2|105/128|d.15.4.1|1/1|2Fe-2S ferredoxin-like| OP:NHOMO 701 OP:NHOMOORG 279 OP:PATTERN -------------------------------------------------------------------- --1-3--2112---65534-35--4A3333346888A5LH11-31-12----3111----431-243233----------------------------------11-1-------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------111------11533---1--11------------112113-1-2--11112-12234332----341--122511111111---12-----------------------------------4-11412252363643334666523331383A5A66-142443---624279-6-11-1------------151----------------------------11-----------------------------211-1-1-11-------------1----1----------------12--2211-2---22-12221--2121-1112112444---------------------21111111---22222222222----------------32-----1---------2334311-----33332313145232111-----------1-111111--1--1122322------------------------------------------------------------------ ----1----------1-1-----1111---------------------11322211111111------------------------------------------------------------------------------------------------------------------------------11----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 311 STR:RPRED 99.7 SQ:SECSTR #cccEHHHHHHTTTTTccHHHHHHHcTTccccHHccTTccccccccEEcHHHHHHHHHHHHHTTccTTTcccccccccTTcTTcccTTTEEEEEEEccccccccTTccEEEEccGGGGHHHHHHHHHHHHHHHHHHccEEccccccTTTTHHHHHHGGGEEEEEEEcccTTcHHHHHHHHTTTcEEEEEEccccHHHHHHHHHHHHHHHTTccHHHHccHHHTTHHHHHHHHHHcEEEEccTTccHHHHHHTTTcccccccccccccccccEEEEccEEcccccccHHHHHHTccccccccEEcccEEEEEE DISOP:02AL 312-313| PSIPRED cccEEEEEEEEEEEccccEEEEEEEccccccccccccccEEEEEcccccEEEEEEccccccccEEEEEEEEEcccccHHHHHHHcccccEEEEEccccccEEccccccEEEEEccHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHcccccEEEEEccccHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHccccHHHEEEEcccccccccccEEEEEcccccEEEEcccccHHHHHHHcccccccccccccccccEEEEEEEEEEccccccccHHHHHccEEEEEEEEEcccEEEEEc //