[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56960.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->107 3f3xA PDBj 2e-05 33.3 %
:RPS:PDB   15->115 3ecoA PDBj 9e-11 18.2 %
:RPS:SCOP  17->115 2fbiA1  a.4.5.28 * 1e-15 23.7 %
:HMM:SCOP  8->147 1jgsA_ a.4.5.28 * 3e-25 29.4 %
:HMM:PFM   38->97 PF01047 * MarR 3.1e-11 29.3 58/59  
:BLT:SWISS 17->109 PECS_DICD3 9e-07 31.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56960.1 GT:GENE BAD56960.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2285825..2286289) GB:FROM 2285825 GB:TO 2286289 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56960.1 LENGTH 154 SQ:AASEQ MGIGDDAVEVRAQGWRTLAALHALIESALERELAAVELSVVEYTVLDALSRQDGWHMRMQQLARATALSPSATTRLVNRLENRHLLQRVLCADDRRGIYTELTAPGRALYERARPLHDAALKRALDDAAAQPELAPVVAALHDLALPRATATPD GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 17->109|PECS_DICD3|9e-07|31.2|93/166| SEG 116->130|lhdaalkralddaaa| BL:PDB:NREP 1 BL:PDB:REP 36->107|3f3xA|2e-05|33.3|69/139| RP:PDB:NREP 1 RP:PDB:REP 15->115|3ecoA|9e-11|18.2|99/135| HM:PFM:NREP 1 HM:PFM:REP 38->97|PF01047|3.1e-11|29.3|58/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 17->115|2fbiA1|1e-15|23.7|97/136|a.4.5.28| HM:SCP:REP 8->147|1jgsA_|3e-25|29.4|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 50 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ----3-1---1--------------1----------4222-211-11-1---312--1----111-1443-----------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 72.1 SQ:SECSTR ####ccHHHHHTcHHHHHHHHHHHHHHHHHHHHGGGTccHHHHHHHHHHHHcTTTcEEHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccccEEEEEEEcHHHHHHHHHHHH####################################### DISOP:02AL 146-154| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccc //