[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56962.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  235/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
d.159.1
:399 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   164->292 3c8gD PDBj 1e-13 11.3 %
:RPS:SCOP  164->236 2nxfA1  d.159.1.12 * 3e-09 27.4 %
:HMM:SCOP  152->385 4kbpA2 d.159.1.1 * 9.2e-36 27.3 %
:HMM:PFM   160->325 PF00149 * Metallophos 7.9e-14 25.9 166/200  
:BLT:SWISS 131->382 TMPPE_DANRE 7e-44 38.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56962.1 GT:GENE BAD56962.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2287594..2288793) GB:FROM 2287594 GB:TO 2288793 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56962.1 LENGTH 399 SQ:AASEQ MRSAESPRIPLKYLPRVILFLAVPALLFVFPWWTLVAAPSGGTGALFALGTAACLLGALTLPAAMVLGHGPRQSDAAALLGDTLLGVAWVFFTWSALGAVVNVALGAAGIAGHAGPVALAVLVIASALICYGLAEAARVPRVRTREIPIAGLGRGLDGVRLVVITDTHFDARNRVRWSRRVVELINAQQPDIVCHAGDLADGSVERRHRQVDPLEKVAAPLGRFYITGNHEYFGDAAGWIAHMSSLGWQPLRNAHEVLTRAGDSLVLAGIDDPTGVVLPGHGPDLRAALDGADPALPVVLLAHQPRQVADAAAAGVALQISGHTHGGQIWPFHYLVRLEQPVVAGLSRHGEHTWLYTSRGTGYWGPPLRVFAPSEITVLVLRTHPAVTPRRAPRPPAAR GT:EXON 1|1-399:0| BL:SWS:NREP 1 BL:SWS:REP 131->382|TMPPE_DANRE|7e-44|38.5|252/437| TM:NTM 4 TM:REGION 13->35| TM:REGION 46->68| TM:REGION 81->103| TM:REGION 115->137| SEG 19->31|lflavpallfvfp| SEG 41->64|ggtgalfalgtaacllgaltlpaa| SEG 75->88|daaallgdtllgva| SEG 96->129|algavvnvalgaagiaghagpvalavlviasali| SEG 151->163|glgrgldgvrlvv| SEG 308->317|vadaaaagva| SEG 389->398|prraprppaa| RP:PDB:NREP 1 RP:PDB:REP 164->292|3c8gD|1e-13|11.3|124/153| HM:PFM:NREP 1 HM:PFM:REP 160->325|PF00149|7.9e-14|25.9|166/200|Metallophos| RP:SCP:NREP 1 RP:SCP:REP 164->236|2nxfA1|3e-09|27.4|73/314|d.159.1.12| HM:SCP:REP 152->385|4kbpA2|9.2e-36|27.3|227/0|d.159.1.1|1/1|Metallo-dependent phosphatases| OP:NHOMO 391 OP:NHOMOORG 270 OP:PATTERN ----------------------------------1-----------------2--------------- 111------------------2---1------11112211--------------------11--21-112-------------1--112232-2112--111111211-2-----------------1--------111-----6----------------------11--------------2------1111223234431343444-122113341112211------21--------------------2----------------------222---------------------------------------------2111-------1-12111----1-1--2--1-22-1-1------1-1-211----------1111---------------------32-32222-------1--------------------------------22--1-------------------------------------111-11111111111111111111-11111111--11----11111-1----------------------12111-1-2--1-----1-12-111122154222111111111112111111111--1------------1----------------------1-------------------------------------------------11--------------------------------------------------------1--111111-----1-----------2------------------11------------------------11--------------1-22--22----------------------------------------------1-3 -----------------------------------------------------------------------------------------------------------1-------11--1--1-1111-251---1111---1---111---11--11-22111-------332--------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 55.9 SQ:SECSTR ###################################################################################################################################################################HHHHHHcccHHHHHHHHHHHHHHTTGGGGcccccHHHHHHTHHHHcTTcTTccHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHTcccccTTcHHHHHHHTTcHHHHTcHHHHHHccHHHHHHHccHHHHcTcccTTcccccccTTcccccccEEEEEEEcccEEEEEEcccccEEEEEEEEcHHHHcEEEEEETTTTEEcccccccEEEEEEEGGTccccE############# DISOP:02AL 1-6, 8-9, 386-399| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHcccEEEccccEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHcccEEEEEEcccccEEEEcccccccccccEEEEEEEcccEEEEEEcccccccccEEEccccEEEEEEEEccccccccccccccccc //