[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56963.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->43 PF07561 * DUF1540 9.1e-08 39.4 33/40  
:HMM:PFM   62->90 PF07561 * DUF1540 3.8e-06 31.0 29/40  
:REPEAT 2|9->45|59->98

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56963.1 GT:GENE BAD56963.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2288904..2289203) GB:FROM 2288904 GB:TO 2289203 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56963.1 LENGTH 99 SQ:AASEQ MTTMEMPHVSECTVSDCSYNHDGCHAYAINVAGQNGSADCTTFIPLSAKGGLDRVTSMVGACQRVDCTHNQNLECTAPEIRVGLGASDHSANCLTYSPA GT:EXON 1|1-99:0| NREPEAT 1 REPEAT 2|9->45|59->98| HM:PFM:NREP 2 HM:PFM:REP 11->43|PF07561|9.1e-08|39.4|33/40|DUF1540| HM:PFM:REP 62->90|PF07561|3.8e-06|31.0|29/40|DUF1540| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------11--1----1111---11-11-1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccEEcccEEEEEEEEEccccccccEEEEEEEEcccccccccEEEEcHHcccccccccccccEEEEccEEcccEEEEccEEEEEEccccccEEEEEEccc //