[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56969.1
DDBJ      :             putative ABC transporter
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  180/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.19c.94.1
:386 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->266 2g29A PDBj 3e-13 25.7 %
:RPS:PDB   38->319 1eexA PDBj 7e-23 10.7 %
:RPS:SCOP  38->319 1dioA  c.1.19.3 * 3e-23 10.7 %
:HMM:SCOP  39->277 1xs5A_ c.94.1.1 * 2.2e-34 32.4 %
:BLT:SWISS 36->266 NRTA_ANASP 4e-17 28.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56969.1 GT:GENE BAD56969.1 GT:PRODUCT putative ABC transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2294108..2295268) GB:FROM 2294108 GB:TO 2295268 GB:DIRECTION - GB:PRODUCT putative ABC transporter GB:PROTEIN_ID BAD56969.1 LENGTH 386 SQ:AASEQ MSGLSRRALLCGCAGLVAAGGVAGLTDLARAAGGDRVDTTGPLRIGYLPITDAAPLLVAHGAGTVAPGTVAAAKPVLFRSWAALAEAFLSRQVDVVHLLMPMAVQLRYGLGADVRVLGWNHTNGSALTVAPHITEPEQLAGTQVAIPFWWSIHNILIQRYLRAHGLRPVIRRAASRADRSVELIVMSPSDMVPALANGSIAGYTVADPFNAAAQVRGIGRIHRYLGDLWRDHACCALVVHQDLLDRRPEVAQALTDGIVAAQRRIDTDRAATAKLLAGTYLPQPLPAITTALTYPQPPPLRHPDWQPQRIGFQAFPFPSFTAALVAAMPDTVVDGDTRFLSRLDPDRVHGELVDDRFVRTTLARAGGPAAVGLPDSLTRTEEIDPS GT:EXON 1|1-386:0| BL:SWS:NREP 1 BL:SWS:REP 36->266|NRTA_ANASP|4e-17|28.1|221/440| SEG 8->25|allcgcaglvaaggvagl| SEG 58->73|vahgagtvapgtvaaa| BL:PDB:NREP 1 BL:PDB:REP 44->266|2g29A|3e-13|25.7|214/385| RP:PDB:NREP 1 RP:PDB:REP 38->319|1eexA|7e-23|10.7|272/551| RP:SCP:NREP 1 RP:SCP:REP 38->319|1dioA|3e-23|10.7|272/551|c.1.19.3| HM:SCP:REP 39->277|1xs5A_|2.2e-34|32.4|222/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 254 OP:NHOMOORG 189 OP:PATTERN ----------------------------------------------11111111-------------- -------1111---1----------1----------1----111-----------1---------------------------------------------------------------------1---1--------------111132114--231-----1312441-1--------------------------------------------------------------11111-11111111----1-------------------------------------------------------------------------------------1---------1----------------1--------------------1211-111--21------------33233-4--1--2111--------311--11--------------------21----------------------------------11------1222211111111111111-11131111-21111211121321211-1211-------------11-24----------1-11--1---------1-1--11-------------------------------1-------------------------2--------1-1--1-------------------------------12111------------------------------------------------------11--1-----------1---11--1-----1122222111222211111---------1-----------------1111------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 334 STR:RPRED 86.5 SQ:SECSTR #####################################TTccHHHHHHHHHHHHHTTcEEEEEccTTHHHHTTccTTcHHHHHHHHHHTccEEEcccGGGTTTGGGcTTHHHHHHHHTTcEEEcccccccccHHHHHHHHHHHTTccccccEEEEcccGGGcTTccccccGGGcccHHHHHHHHHHHTcccccccccHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHGGcHHHHcccGGGcccccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHTcHHHHHHHHHHHHGGGcTTcEEETTTEEEcTTTcccccccccHHHHHHHHHHHHHHHHTTcccccccccHHHHccHHHHHHHHHTGccHHHH############### DISOP:02AL 1-4, 379-386| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcHHHHHHHHHHHHccHHHHccccEEEEEEcccHHHHHHHHHHcccEEEEccHHHHHHHHHcccccEEEEEEEcccccEEEEccccccHHHHcccEEEEEccccHHHHHHHHHHHHccccHHHHHHcccccccEEEEEccHHHHHHHHHcccEEEEEEcccHHHHHHHHcccEEEEEcHHHcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccc //