[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56970.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  902/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:233 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   3->201 1z47B PDBj 7e-30 47.7 %
:RPS:PDB   6->207 3dmdC PDBj 5e-36 12.4 %
:RPS:SCOP  5->202 1sgwA  c.37.1.12 * 2e-35 14.9 %
:HMM:SCOP  1->204 1ii8.1 c.37.1.12 * 6e-59 42.2 %
:RPS:PFM   40->151 PF00005 * ABC_tran 1e-10 38.4 %
:HMM:PFM   40->153 PF00005 * ABC_tran 1.3e-22 38.9 108/118  
:HMM:PFM   20->46 PF01935 * DUF87 3.5e-05 48.1 27/229  
:HMM:PFM   172->211 PF05226 * CHASE2 0.00076 42.1 38/310  
:BLT:SWISS 16->201 CYSA_BRAJA 7e-35 54.3 %
:PROS 125->139|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56970.1 GT:GENE BAD56970.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2295265..2295966) GB:FROM 2295265 GB:TO 2295966 GB:DIRECTION - GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD56970.1 LENGTH 233 SQ:AASEQ MSGGRKSYPGRAAPVLDGIDLAVAAGETLAVLGASGSGKSTLLRVLAGLDRLDGGTVDWSGSPVPPATGTVFQQPLLMPWLTVGDNILFGGRFARHREGFDAAHARDLLGRFGLGALADRYPDQLSGGQAQRVAVIRAAAVRPRLLLLDEPFNALDPAVRADLQDWLRGLVRELSCATVLVTHDVDEALRVADRIVLIGPGAAVREDLRVTGEDPAHVRERIVAGYRETVVPA GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 16->201|CYSA_BRAJA|7e-35|54.3|186/344| PROS 125->139|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 132->148|rvaviraaavrprllll| BL:PDB:NREP 1 BL:PDB:REP 3->201|1z47B|7e-30|47.7|197/342| RP:PDB:NREP 1 RP:PDB:REP 6->207|3dmdC|5e-36|12.4|193/318| RP:PFM:NREP 1 RP:PFM:REP 40->151|PF00005|1e-10|38.4|112/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 40->153|PF00005|1.3e-22|38.9|108/118|ABC_tran| HM:PFM:REP 20->46|PF01935|3.5e-05|48.1|27/229|DUF87| HM:PFM:REP 172->211|PF05226|0.00076|42.1|38/310|CHASE2| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 5->202|1sgwA|2e-35|14.9|188/200|c.37.1.12| HM:SCP:REP 1->204|1ii8.1|6e-59|42.2|199/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 31075 OP:NHOMOORG 1139 OP:PATTERN MMB6CC86DEDDBBEBaCCFCFEKhJNUWHXJ94B777DCCC6KSJOUDLoeT6HHDIEBE995L155 IMSK*SRSYXZOSKSSRLL-Lb77U*LKLLLMohfjj***R*R*p*sYdbUMzwrKMZ45mkpX*ov***VNOMMfQOOHjPf64768FFCC1A9A8--6778ADH7FDD344444455755559HGCHLDCLFIISXYfjABAjPTJOZOOQQWJLGDGEGENONUbbcH6F79767D89B7ULRLJML6QRkqrtrvt**hz*zsv**kddhk*y*QYkreWZWaaXZW**LRRRSRNPOPRRRNNLSQMJcQTKhhLKHKJffLMffPLJQRQRSRUTVSVRVYZYSTTSQRQURTRNMNNMNNNOONMNWOPNLNRQRTFvXlmZaZfcdYPaSPiZZLMLImLPNLtPPMF**WSMMRVITKIMEBCJLCSPPPGDABBCXR***MLe*wk*iyzy**w*sw**-fh*ca*h***O7**************CEIw*******x*LKLLLLLLkXZFOUWs54534333322223323232232235344AABHFBt**x*******pnlni****wruuYw***up*m3Bnmhrbmae*j****QXTKMEHbSEECCDDCKIGNXORX*IVQeaJZdUTaAQPNKNMWONONLPcnPk6BBD6AAAA775589988876F689FEhehBYJI9D8fEGIHHBFMJIIJHJLIKLK4-8CMIE------qn**Rrehlkhikelgi-kigiiihjeilkgfgggfd*****RRQYXWXZZYZZaYWYWXX*bZaeecgJ1iopoppoonppq23AA88678CCDCJDvi*KKLPPPBFIFFLGITJKLJKEJAGJbKmjklo***eqxhlS***555455555BSZZkdeeeeglgnmLKKGJGGGHGA89812CHGG98AB46555555PAC72534-5463664678465453333EQMFDTcTSQ7RH ----654-C4157A43252366253433311-1543232432311132444755225112221--1-111---1-------212--1--5-2213153411-2-2126J45AD9H58415-195ED16-Ca8-649483-811D545511512Q2982I5FG1C5H6CFAVBL835453t45456LCEd3YC47L8KI9 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 232-234| PSIPRED ccccEEEcccccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEccccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHccHHHcccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEccccEEEEEcccccccccccccHHHHHHHHHHccc //