[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56972.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   96->158 PF10799 * YliH 0.00071 39.3 61/127  
:BLT:SWISS 26->68 LPXB_SOLUE 8e-04 41.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56972.1 GT:GENE BAD56972.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2296994..2297512) GB:FROM 2296994 GB:TO 2297512 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56972.1 LENGTH 172 SQ:AASEQ MSLYLYELVPAIDPGKAVDELARRFGEAGGELIEAQVTGDAGRIFAIAEFESCRGPRLEPDGALGDIDGPHEVRLVGAELAQLKAARPAAGYLVEWDIPAEIDMETYLARKKANSPKYADVPEVDFLRTYVREDMDKCLCFYDAPDEAAVRRARAAVSTPVDRLHALTDPRT GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 26->68|LPXB_SOLUE|8e-04|41.9|43/100| SEG 148->157|aavrraraav| HM:PFM:NREP 1 HM:PFM:REP 96->158|PF10799|0.00071|39.3|61/127|YliH| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- --------------1----------1----------1------------------1-----------------------------------------------------------------------------------------1------1---1-----------------------------------------------------------------------------11111111111111----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 171-172| PSIPRED cEEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEEcccccccccccccccccccHHHHHEEcccHHHcccccccccEEEEEEccccccHHHHHHHHHHccccHHHcccHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHccccHHHHHHHccccc //