[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56975.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->56 PF10370 * DUF2437 0.00086 35.5 31/50  
:BLT:SWISS 27->67 ZNUC_RHIEC 4e-04 36.6 %
:REPEAT 4|37->50|54->69|70->83|86->98
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56975.1 GT:GENE BAD56975.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2298434..2298733) GB:FROM 2298434 GB:TO 2298733 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56975.1 LENGTH 99 SQ:AASEQ MTAAAHQEHTDHGHVHGEGCGHVAFPHADHIDYAHDGHIHRAHDGHFDECEPTGHRTHEAHDHRHGEGCGHVAVPHGDHVDYLHDGCRHAAHDDHYDEH GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 27->67|ZNUC_RHIEC|4e-04|36.6|41/100| NREPEAT 1 REPEAT 4|37->50|54->69|70->83|86->98| SEG 12->23|hghvhgegcghv| HM:PFM:NREP 1 HM:PFM:REP 6->56|PF10370|0.00086|35.5|31/50|DUF2437| OP:NHOMO 16 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- --1--1--------1---------------------1------------11----------2----1-----------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------ ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14, 92-99| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccc //