Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56978.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:172 amino acids
:HMM:PFM   19->161 PF01947 * DUF98 6.1e-07 25.9 135/149  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56978.1 GT:GENE BAD56978.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2302099..2302617 GB:FROM 2302099 GB:TO 2302617 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56978.1 LENGTH 172 SQ:AASEQ MSAAGAIAGFADPLTRVLLAGDGFTMSSLEAILGAPLLVRVRRQIEVPARRLPDHVTDALRVPGAERVLLRRSALVTADQRLASVNHVVAVRGPAAATGLDDVRVPIGAGLIARGVAQRRRILWAGLRRWPDGRPCAARSYLMVVQDRPLCFVRESFDPDLVPPDHLLEPRS GT:EXON 1|1-172:0| HM:PFM:NREP 1 HM:PFM:REP 19->161|PF01947|6.1e-07|25.9|135/149|DUF98| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 169-172| PSIPRED ccccccHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHcccHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccccEEEEEcccccccccccccccccc //