[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56982.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  25/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->183 3dtnB PDBj 3e-12 29.3 %
:RPS:PDB   10->182 3bzbA PDBj 9e-10 12.9 %
:RPS:SCOP  40->156 1im8A  c.66.1.14 * 7e-12 23.7 %
:HMM:SCOP  7->197 1rjdA_ c.66.1.37 * 1.6e-29 32.1 %
:RPS:PFM   39->150 PF05175 * MTS 2e-05 33.0 %
:HMM:PFM   52->153 PF08241 * Methyltransf_11 1.5e-10 35.1 94/95  
:HMM:PFM   5->31 PF09179 * TilS 0.00096 37.0 27/69  
:BLT:SWISS 25->151 TAM_VARPS 3e-11 36.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56982.1 GT:GENE BAD56982.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2307514..2308281 GB:FROM 2307514 GB:TO 2308281 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56982.1 LENGTH 255 SQ:AASEQ MTTSELDIERARYWVRRWDRQQEHYMPDREQRFEVIGDVLAEIVRRPDPLIVDLGVGPGTLSDRLLVRFPEATVVGVDADPLLLALAERTLGSPRFRTVDADLREPDWPARLELDRAPDAFVSTTALHWMNREPLRALIGACADMLAPGGVFVNGDHLYEGERGPRLDTLGAALTRRRAERVGTAAAEDWAAWWAAVAAAPELAELVRLRDGGFEHTVHDRPSVHDYVEFARAAGFAEAGIVWQYGDDRVVVGIR GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 25->151|TAM_VARPS|3e-11|36.4|118/259| SEG 185->205|aaaedwaawwaavaaapelae| SEG 229->240|efaraagfaeag| BL:PDB:NREP 1 BL:PDB:REP 17->183|3dtnB|3e-12|29.3|157/213| RP:PDB:NREP 1 RP:PDB:REP 10->182|3bzbA|9e-10|12.9|171/188| RP:PFM:NREP 1 RP:PFM:REP 39->150|PF05175|2e-05|33.0|112/154|MTS| HM:PFM:NREP 2 HM:PFM:REP 52->153|PF08241|1.5e-10|35.1|94/95|Methyltransf_11| HM:PFM:REP 5->31|PF09179|0.00096|37.0|27/69|TilS| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF05175|IPR007848| RP:SCP:NREP 1 RP:SCP:REP 40->156|1im8A|7e-12|23.7|114/226|c.66.1.14| HM:SCP:REP 7->197|1rjdA_|1.6e-29|32.1|190/0|c.66.1.37|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 33 OP:NHOMOORG 32 OP:PATTERN ----------------------------------------------------1--------------- ------------------------------------11--------1---------1-------1--111-------------------------------------------------------------------------------------------------111---------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1---------1--1-1---------------1--------------------1---------------------------------------------------1-------------------------------------------------------------------------1------------------------------------------------------------1------------------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------- -----------------------1-11----------------------1--1---------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 184 STR:RPRED 72.2 SQ:SECSTR cccGTTccccEEEEEccccccccEEEEEcccHHHHHHHHHHHcGGTTTcEEEETTcTTcHHHHHHHHTTccEEEEEEcccHHHHHHHHHHHccccEEEEccTTccTHHHHHHHccccccEEEEEcccccGcTGGHHHHHHHHHHcccTTTcTTcEEEEEEcccTHHHHHHHHcTTEEEEEEEcE####################################################################### DISOP:02AL 1-3| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccccEEEEEccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHccccEEEEEEEEEccEEEEEEc //