[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56989.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  818/915 : Eukaryota  146/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:321 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   13->57 2d2fA PDBj 1e-06 48.9 %
:BLT:PDB   44->243 1vplA PDBj 4e-17 27.5 %
:RPS:PDB   6->230 3b5jA PDBj 5e-29 19.8 %
:RPS:SCOP  8->238 1b0uA  c.37.1.12 * 1e-30 21.9 %
:HMM:SCOP  5->241 1g2912 c.37.1.12 * 1.5e-59 42.3 %
:RPS:PFM   50->170 PF00005 * ABC_tran 2e-05 30.5 %
:HMM:PFM   50->170 PF00005 * ABC_tran 7e-18 31.0 113/118  
:HMM:PFM   141->212 PF02702 * KdpD 0.00019 34.7 72/211  
:HMM:PFM   33->60 PF02367 * UPF0079 0.00028 53.6 28/123  
:BLT:SWISS 4->316 DRRA_STRPE 4e-52 43.4 %
:PROS 142->156|PS00211|ABC_TRANSPORTER_1
:PROS 66->74|PS00850|GLY_RADICAL_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56989.1 GT:GENE BAD56989.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2314669..2315634 GB:FROM 2314669 GB:TO 2315634 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD56989.1 LENGTH 321 SQ:AASEQ MQNPDPAIEISRLRKNYRGADAGTGLNGIDLTVAAGTVCALLGPNGAGKTTAVRILATLLRPDAGTARVAGYDVVRDPVRVRERIGLVGQNAAVDEILSGRQNLVMFGRLNGLGPRAAARRAAELLDRFDLAAAGKRPVGDYSGGMRRRLDLAAALIVTPPVLFVDEPTTGLDPAARLQVWAAVTELVAAGTTVLLTTQYLEEADRLADHITLLDQGRVIAAGTPAELKSRVGSDWVETTFDDTSAAEHAAELARPLACGEVTTDPATHTVRIPVLDRAEGVLALADVLRRADLAPRDLDVRTPSLDEVFLHLTRHGKVPA GT:EXON 1|1-321:0| BL:SWS:NREP 1 BL:SWS:REP 4->316|DRRA_STRPE|4e-52|43.4|304/330| PROS 142->156|PS00211|ABC_TRANSPORTER_1|PDOC00185| PROS 66->74|PS00850|GLY_RADICAL_1|PDOC00665| SEG 73->84|dvvrdpvrvrer| SEG 108->134|grlnglgpraaarraaelldrfdlaaa| SEG 182->198|aavtelvaagttvlltt| SEG 282->302|vlaladvlrradlaprdldvr| BL:PDB:NREP 2 BL:PDB:REP 13->57|2d2fA|1e-06|48.9|45/246| BL:PDB:REP 44->243|1vplA|4e-17|27.5|200/238| RP:PDB:NREP 1 RP:PDB:REP 6->230|3b5jA|5e-29|19.8|222/243| RP:PFM:NREP 1 RP:PFM:REP 50->170|PF00005|2e-05|30.5|118/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 50->170|PF00005|7e-18|31.0|113/118|ABC_tran| HM:PFM:REP 141->212|PF02702|0.00019|34.7|72/211|KdpD| HM:PFM:REP 33->60|PF02367|0.00028|53.6|28/123|UPF0079| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 8->238|1b0uA|1e-30|21.9|228/258|c.37.1.12| HM:SCP:REP 5->241|1g2912|1.5e-59|42.3|234/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 6021 OP:NHOMOORG 1028 OP:PATTERN 554233469888896785544663846C5C752231--212118D-9956B9715775B493647-12 58O4V34555536278666-67339C666667BCBDIFDD5D9I8N7E875-775455--FEC4BDEKMT523334443273E122111141-1--2---32112B15941111111212111123121--32133ABBDC666GC43555355655122223745B575313111113111154343553427888889A88788998B455548782445635655456DE3---1----------122322322662222455117A222212132655221254523222113212222222212222263422344417B4G49899A994842A99411-B7521D4674AB7673623752864-285B78851111245FHK426998788B8B99BA99C-55D65859BI8-HEEEFDCKIKKFDB45669JBAADEAB1111111161211777-----------------------------4332436A767A9998A67675CCGL6666288AJB9C8-28877646584BCAD54873334311111113345878A6741414344562655573468BC9BB999211221111111111111111-22153467375647426555556644346367468--14543------86553746666666666-6656666666666666666BAB694557678888888868687966577563-577888876889-11312222444473A75111323111112113-12111-11-6566664845867567534323232332325523444436355564343445522221132333455--------3-1---1--1---11-11---1--11113761288887394 ----9A6-IA27CF4-22111111-1111----1111111-11111--221121-12111111---------------------------21211-------1----375C9BCHAB747389AQQ6H6W*G2G9K7AA8F85E98B866I77n5EB7E59T99653BAET48953472a11152C5541C932GADBA ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 317-321| PSIPRED ccccccEEEEEEEEEEEcccccEEEEEccEEEEEccEEEEEEccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHHHHcccEEEEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHcccccc //