[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56992.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->91 PF06724 * DUF1206 3e-05 38.2 %
:RPS:PFM   228->271 PF06724 * DUF1206 9e-06 50.0 %
:HMM:PFM   26->94 PF06724 * DUF1206 1.4e-19 39.1 69/73  
:HMM:PFM   111->183 PF06724 * DUF1206 2.3e-17 35.6 73/73  
:HMM:PFM   200->271 PF06724 * DUF1206 1.3e-20 37.5 72/73  
:HMM:PFM   7->44 PF07835 * COX4_pro_2 0.00045 21.1 38/44  
:BLT:SWISS 19->111 YXXB_BACSU 8e-06 27.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56992.1 GT:GENE BAD56992.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2316937..2317752) GB:FROM 2316937 GB:TO 2317752 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56992.1 LENGTH 271 SQ:AASEQ MVFGNTSAAASTDRIAQHPTFERFARAGFVMTGIVHLIVAYLALRVAFGGGGTADQSGAMAQIAAAPGGRVVLWIAVAAFLLMALWRLAEAVFGSASKPDHDNRRKEAMRRGKALAVAVVYAALALTAFTFARGGGKSSSGESQSLTARLLANTAGKAVLIAAGLVVLGVGAYYVYKGVTGKFLKDLDTAGPAIRRLGTAGHIAKGLAIGAIGALLILAVAQSDPSRSAGLDGALKTLLAQPYGVVLLVLAAIGIATYGLFSFVQARHAKM GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 19->111|YXXB_BACSU|8e-06|27.8|90/100| TM:NTM 6 TM:REGION 27->49| TM:REGION 73->95| TM:REGION 113->135| TM:REGION 154->176| TM:REGION 201->222| TM:REGION 240->262| SEG 114->132|alavavvyaalaltaftfa| SEG 134->145|gggksssgesqs| SEG 155->182|agkavliaaglvvlgvgayyvykgvtgk| SEG 200->221|aghiakglaigaigallilava| RP:PFM:NREP 2 RP:PFM:REP 26->91|PF06724|3e-05|38.2|66/73|DUF1206| RP:PFM:REP 228->271|PF06724|9e-06|50.0|44/73|DUF1206| HM:PFM:NREP 4 HM:PFM:REP 26->94|PF06724|1.4e-19|39.1|69/73|DUF1206| HM:PFM:REP 111->183|PF06724|2.3e-17|35.6|73/73|DUF1206| HM:PFM:REP 200->271|PF06724|1.3e-20|37.5|72/73|DUF1206| HM:PFM:REP 7->44|PF07835|0.00045|21.1|38/44|COX4_pro_2| OP:NHOMO 26 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- -------1-------------2---1------12221111-1-1--1------31-------1------------------------------------------------------------------------------------1-----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 11-12, 49-59, 98-106, 131-148, 221-231| PSIPRED ccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccEEHHHHHHHHHEEHHHHHEEHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //