[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56995.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:220 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   102->163 PF11292 * DUF3093 0.00044 24.1 58/143  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56995.1 GT:GENE BAD56995.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2321863..2322525) GB:FROM 2321863 GB:TO 2322525 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56995.1 LENGTH 220 SQ:AASEQ MTTLQDHSTAAPRTSYEEELVHMMDDIDALIEKQTVPLYRKILINYRRHALLEVSGRYDELLQPEMTVAHPRYRIFEGGQGVILDGMDQVRGFYRSLAELDMLVMWTGRQRIAVGDHGFAGEAEFSQFVPGKMLGDNVFASMDDAAAKTDSGYDPDAYYLVRRTLAFVWPYDETGRMVGEHVYEDTNSKTVTRVDTAEVITGARAAELLAPLIEKYELPA GT:EXON 1|1-220:0| HM:PFM:NREP 1 HM:PFM:REP 102->163|PF11292|0.00044|24.1|58/143|DUF3093| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------111-------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHccccccccccEEEEEcccccccccHHHHHHHHHHHHHcccEEEEEcccEEEEcccEEEEEEEEEEEccHHHHHcccHHHHHHHHcccccccccccEEEEEEEEEEEEEcccccEEEEHHHEEcccccEEEEEcccccccHHHHHHHHHHHHHHHcccc //