[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56997.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.82.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->142 3cjxF PDBj 1e-06 38.2 %
:RPS:PDB   20->123 3ebrA PDBj 1e-06 18.6 %
:RPS:SCOP  24->139 2o1qA1  b.82.1.21 * 6e-37 29.3 %
:HMM:SCOP  1->127 1y3tA1 b.82.1.5 * 3.4e-09 18.3 %
:HMM:PFM   61->119 PF07883 * Cupin_2 6.4e-05 25.9 58/71  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56997.1 GT:GENE BAD56997.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2323330..2323881) GB:FROM 2323330 GB:TO 2323881 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56997.1 LENGTH 183 SQ:AASEQ MTISAPVGPTFWMQNPGTTPKGARKEFVDPDDIPWTDWLMPGTRFKLLYANLATGAFTVILRVDPGVTATPHWHLGTAQAFLLEGGFHYDPEDPGRAGTYTCEVAGAVHQPVSPTGTTMLAFVDGPIAGYLPDGTLGVVADARLHYYMARDNNAVAHTQVVDYATDPSLSLHDGAPTSEGTPR GT:EXON 1|1-183:0| BL:PDB:NREP 1 BL:PDB:REP 65->142|3cjxF|1e-06|38.2|76/152| RP:PDB:NREP 1 RP:PDB:REP 20->123|3ebrA|1e-06|18.6|102/151| HM:PFM:NREP 1 HM:PFM:REP 61->119|PF07883|6.4e-05|25.9|58/71|Cupin_2| RP:SCP:NREP 1 RP:SCP:REP 24->139|2o1qA1|6e-37|29.3|116/144|b.82.1.21| HM:SCP:REP 1->127|1y3tA1|3.4e-09|18.3|126/0|b.82.1.5|1/1|RmlC-like cupins| OP:NHOMO 12 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------------------------2-----------1-2-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------2----------------------------------------------------2------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 83.1 SQ:SECSTR ccccTTccccccccccEEcGGTcccccccGGGcccEcTTTccccEEEEEEETTTTEEEEEEEEEEccccccEEEcccEEEEEEEcEEETTccccccTTcEEEEcccEEEcEEEcccccccEEEEccEEEEcTTccEEEEEcHHHHHcccccc############################### DISOP:02AL 1-3, 174-183| PSIPRED cccccccccccccccccccHHHHHHHHcccccccEEEcccccEEEEEEEcccccccEEEEEEEccccccccEEEcccEEEEEEEEEEEEcccccccccEEEEEccccEEEEEEccccEEEEEEEEcEEEEcccccEEEEHHHHHHHHHHHccccEEEEEEEEEcccccEEEEccccccccccc //