[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57000.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:104 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->85 2ftrB PDBj 3e-08 45.7 %
:RPS:PDB   1->96 3bf4A PDBj 1e-20 13.8 %
:RPS:SCOP  3->96 2ftrA1  d.58.4.15 * 4e-19 33.0 %
:HMM:SCOP  1->101 2ftrA1 d.58.4.15 * 1.7e-27 37.6 %
:RPS:PFM   4->90 PF07110 * EthD 3e-10 46.5 %
:HMM:PFM   3->98 PF07110 * EthD 1.5e-32 42.7 96/103  
:BLT:SWISS 3->103 YTH4_RHOER 4e-24 47.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57000.1 GT:GENE BAD57000.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2325541..2325855) GB:FROM 2325541 GB:TO 2325855 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57000.1 LENGTH 104 SQ:AASEQ MSYQISVCYGTPDDPAAFDEYYRTTHVPLAAKVPGLAGLSWGKCRSLDGSEPQFYAVAQLRFATEADLQQALASPEMKAAGKDVRNFATGGASMFVQQLESPLS GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 3->103|YTH4_RHOER|4e-24|47.5|101/100| BL:PDB:NREP 1 BL:PDB:REP 9->85|2ftrB|3e-08|45.7|70/90| RP:PDB:NREP 1 RP:PDB:REP 1->96|3bf4A|1e-20|13.8|94/109| RP:PFM:NREP 1 RP:PFM:REP 4->90|PF07110|3e-10|46.5|86/99|EthD| HM:PFM:NREP 1 HM:PFM:REP 3->98|PF07110|1.5e-32|42.7|96/103|EthD| RP:SCP:NREP 1 RP:SCP:REP 3->96|2ftrA1|4e-19|33.0|94/103|d.58.4.15| HM:SCP:REP 1->101|2ftrA1|1.7e-27|37.6|101/0|d.58.4.15|1/1|Dimeric alpha+beta barrel| OP:NHOMO 30 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ----1---------1----------1----------2162-----1------1------------------------------------------------------------------------------------------------------------------------------------------1------------------1--------11----------1-----------------------------------------------------------------------------------------------------------------------------------------------------------111-------1--------------------------------------------1111-------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 96.2 SQ:SECSTR cccccEEEEEEEccTcccHHHHHHTHHHHHHHGGGccEEEEEEccccccTccccEEEEEEEEccHHHHHHHHHHHHHHHHHHTGGGTcccccEEEEEEEE#### DISOP:02AL 104-105| PSIPRED ccEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccEEEEEEEEEccHHHHHHHHccHHHHHHHHHHHHHccccEEEEEEccccccc //