[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57002.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->179 2iaiA PDBj 2e-31 61.9 %
:RPS:PDB   21->202 3dcfB PDBj 1e-11 22.0 %
:RPS:SCOP  21->80 1z77A1  a.4.1.9 * 2e-11 33.3 %
:HMM:SCOP  7->95 1t33A1 a.4.1.9 * 7.9e-13 29.5 %
:HMM:SCOP  90->203 1vi0A2 a.121.1.1 * 9.4e-19 29.8 %
:RPS:PFM   23->67 PF00440 * TetR_N 1e-05 40.0 %
:HMM:PFM   23->67 PF00440 * TetR_N 6.3e-18 40.0 45/47  
:HMM:PFM   138->175 PF08359 * TetR_C_4 0.00057 26.3 38/133  
:BLT:SWISS 21->75 ICAR_STAEQ 1e-06 27.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57002.1 GT:GENE BAD57002.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2327972..2328598) GB:FROM 2327972 GB:TO 2328598 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57002.1 LENGTH 208 SQ:AASEQ MTSARPTQRTGRPGRPGYDLDSLLSVAVKVFNDRGYDATSMEVLAKRLGIAKSAIYHHVSGKGELLELALSRALNGLFAATTEEGAITGRSIDRLEYVVRRAVEVLVAELPYVTLLLRVRGNTPAEKRALARRREFDAFVAGLVAAAGEEGDLHTDVDPALASRLIWGMINSIVEWYRPRGENSADEIADAVVAIVFDGLRRSGPATG GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 21->75|ICAR_STAEQ|1e-06|27.3|55/185| SEG 5->17|rptqrtgrpgrpg| SEG 94->110|rleyvvrravevlvael| SEG 136->153|fdafvaglvaaageegdl| SEG 185->196|adeiadavvaiv| BL:PDB:NREP 1 BL:PDB:REP 21->179|2iaiA|2e-31|61.9|155/196| RP:PDB:NREP 1 RP:PDB:REP 21->202|3dcfB|1e-11|22.0|177/181| RP:PFM:NREP 1 RP:PFM:REP 23->67|PF00440|1e-05|40.0|45/47|TetR_N| HM:PFM:NREP 2 HM:PFM:REP 23->67|PF00440|6.3e-18|40.0|45/47|TetR_N| HM:PFM:REP 138->175|PF08359|0.00057|26.3|38/133|TetR_C_4| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 1 RP:SCP:REP 21->80|1z77A1|2e-11|33.3|60/75|a.4.1.9| HM:SCP:REP 7->95|1t33A1|7.9e-13|29.5|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 90->203|1vi0A2|9.4e-19|29.8|114/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 25 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ----1--1--1---1---------------------11111------------11111-------11111--------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 90.9 SQ:SECSTR ##################cHHHHHHHHHHHHHHTcTTTccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccHccHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHTHHHHccTTccccHHHHHHHHHHHHHHccccHHTTT# DISOP:02AL 1-21, 204-208| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccc //