[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57008.1
DDBJ      :             putative phenylacetic acid degradation protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  122/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->72 3egrB PDBj 2e-22 75.0 %
:RPS:PDB   10->72 3egrA PDBj 3e-21 72.6 %
:RPS:PFM   12->97 PF06243 * PaaB 4e-25 64.0 %
:HMM:PFM   12->100 PF06243 * PaaB 6.4e-39 50.6 89/94  
:BLT:SWISS 13->102 PAAB_ECOLI 4e-35 70.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57008.1 GT:GENE BAD57008.1 GT:PRODUCT putative phenylacetic acid degradation protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2333342..2333650 GB:FROM 2333342 GB:TO 2333650 GB:DIRECTION + GB:PRODUCT putative phenylacetic acid degradation protein GB:PROTEIN_ID BAD57008.1 LENGTH 102 SQ:AASEQ MTETESAGVRADWPLYEVFVRGKRGLNHVHVGSLHAADDEMALRHARDVYTRRNEGVSIWVVPSRAIVASSPSEKDPFFAPSGDKVYRHPTFYDIPDTVPHM GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 13->102|PAAB_ECOLI|4e-35|70.0|90/100| BL:PDB:NREP 1 BL:PDB:REP 12->72|3egrB|2e-22|75.0|60/61| RP:PDB:NREP 1 RP:PDB:REP 10->72|3egrA|3e-21|72.6|62/62| RP:PFM:NREP 1 RP:PFM:REP 12->97|PF06243|4e-25|64.0|86/92|PaaB| HM:PFM:NREP 1 HM:PFM:REP 12->100|PF06243|6.4e-39|50.6|89/94|PaaB| OP:NHOMO 130 OP:NHOMOORG 123 OP:PATTERN -------------------------------------------------------------------- ----1--1--1---1---------------------11111------1----111111--111-111111-----------------------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1111--11111-----------------2------------1---11-1---111-----11--------1---------------------------------------1--111111111112111211111111111112221--11111---1---11-------------------211---------------------------------------------------------------------1------------------1--------------------1---1---11--111---1-1-----1--1111---------------------1--------------------------------------1---------------11111-----------11---1111----------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 60.8 SQ:SECSTR #########cccccEEEEEEEcTTccccEEEEEEEcccHHHHH#HHHHHTTTTcTTcEEEEEEGGGcccccc############################## DISOP:02AL 1-9, 101-102| PSIPRED ccccccccccccccEEEEEEEcccccccEEEEEcccccHHHHHHHHHHHHcccccccEEEEEcHHHHccccHHHHHHHcccccccccccccccccccccccc //