[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57009.1
DDBJ      :             putative phenylacetic acid degradation protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  128/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->298 1otkA PDBj 1e-44 42.6 %
:RPS:PDB   19->223 3dhhB PDBj 2e-09 8.1 %
:RPS:SCOP  44->299 1otkA  a.25.1.2 * 5e-56 40.7 %
:HMM:SCOP  43->300 1otkA_ a.25.1.2 * 4.3e-63 45.3 %
:RPS:PFM   51->305 PF05138 * PaaA_PaaC 2e-23 36.2 %
:HMM:PFM   38->305 PF05138 * PaaA_PaaC 6.6e-88 47.2 254/263  
:BLT:SWISS 46->305 PAAC_ECOLI 3e-45 42.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57009.1 GT:GENE BAD57009.1 GT:PRODUCT putative phenylacetic acid degradation protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2333661..2334578 GB:FROM 2333661 GB:TO 2334578 GB:DIRECTION + GB:PRODUCT putative phenylacetic acid degradation protein GB:PROTEIN_ID BAD57009.1 LENGTH 305 SQ:AASEQ MIDHDSAFSGLLDGDGDGQWAFGTSFDDPLAGVDTTVPADVDTAALAAYCLMLGDDALIAAQRLSEWAARAPELEEDVALLNIGLDLLGQARLLLARAGAADPAVVPFISATSPVPAEDALAFFRDDHAFRCVRLVEVDNGDFARTVVRLLVLSTWRLAVFDRLRDSRDPVLAAVADKGVKELTYHRDYAARWTVTLGCGTAESRRRMTEALAFVWPFVAELFVPSAEELALAEAGVAVDPRAVRAEFDRVLAQVLHAAELPAPPSTSVGTVGGRAGRQGLHTEALGPLLTEMQCVARAHPEGTW GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 46->305|PAAC_ECOLI|3e-45|42.1|242/100| SEG 85->107|ldllgqarlllaragaadpavvp| SEG 227->235|aeelalaea| BL:PDB:NREP 1 BL:PDB:REP 46->298|1otkA|1e-44|42.6|235/244| RP:PDB:NREP 1 RP:PDB:REP 19->223|3dhhB|2e-09|8.1|197/305| RP:PFM:NREP 1 RP:PFM:REP 51->305|PF05138|2e-23|36.2|235/260|PaaA_PaaC| HM:PFM:NREP 1 HM:PFM:REP 38->305|PF05138|6.6e-88|47.2|254/263|PaaA_PaaC| RP:SCP:NREP 1 RP:SCP:REP 44->299|1otkA|5e-56|40.7|241/244|a.25.1.2| HM:SCP:REP 43->300|1otkA_|4.3e-63|45.3|243/0|a.25.1.2|1/1|Ferritin-like| OP:NHOMO 138 OP:NHOMOORG 130 OP:PATTERN -------------------------------------------------------------------- ----1--1--1---1---------------------11111------1----111111--111-112111-----------------------------1-----1-----------------------------------------------------------------------------11111-------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1-------------1111--11111-----------------2------------1---11-1---111-----11--------1---------------------------------------1--111111111112111211111111111112221--11111---1---11-------------------211---------------------------------------------------------------------1------------------1--------------------1---1---11--111---1-1-----1--1111---------------------1--------------------------------------1---------------11111-----------11---1111----------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 90.5 SQ:SECSTR ##################HHHHHHHHHHHHHTTGGGGccTTHHHHHHHHTTTHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGTcGGHHHHcTTccTTTcHHHHHHHcHHHHHHHHTTcccHHHHHHHHHTTHHHTHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcTHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHTTccccGGGGHHHHHHHHHHHHHHTTccccccccccc####cGGGTcccTTHHHHHHHHHHHHH####### DISOP:02AL 1-4, 303-305| PSIPRED ccccHHHHHHHHHccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccHHHHHHcccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccHHHHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccc //