[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57010.1
DDBJ      :             putative phenylacetic acid degradation protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  138/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.52.8
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->96 1uwdA PDBj 1e-04 25.3 %
:RPS:PDB   8->97 3cq2A PDBj 9e-18 31.0 %
:RPS:SCOP  8->98 1uwdA  d.52.8.2 * 5e-19 24.4 %
:HMM:SCOP  1->99 1uwdA_ d.52.8.2 * 2.7e-19 34.7 %
:RPS:PFM   13->68 PF01883 * DUF59 7e-09 49.1 %
:RPS:PFM   127->162 PF03811 * Ins_element1 1e-05 47.1 %
:HMM:PFM   10->68 PF01883 * DUF59 1.2e-17 41.4 58/76  
:HMM:PFM   127->161 PF03811 * Ins_element1 0.00027 41.2 34/88  
:BLT:SWISS 10->165 PAAD_ECOLI 4e-33 43.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57010.1 GT:GENE BAD57010.1 GT:PRODUCT putative phenylacetic acid degradation protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2334575..2335078 GB:FROM 2334575 GB:TO 2335078 GB:DIRECTION + GB:PRODUCT putative phenylacetic acid degradation protein GB:PROTEIN_ID BAD57010.1 LENGTH 167 SQ:AASEQ MTVAVDPRRLVDSVPDPELPMLTLADLGIVRAVEVEADGTVAVTITPTYSGCPAIATMRADITRTLRRHGYPEVRLHTALAPAWSSDWISAEGRRKLREHGYSLPGPAPRRASGPVPLTLTARPRALTCPHCGSAETEVVAEFGATLCKAQYRCRACREPFEHVKEI GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 10->165|PAAD_ECOLI|4e-33|43.8|146/167| BL:PDB:NREP 1 BL:PDB:REP 22->96|1uwdA|1e-04|25.3|75/102| RP:PDB:NREP 1 RP:PDB:REP 8->97|3cq2A|9e-18|31.0|87/95| RP:PFM:NREP 2 RP:PFM:REP 13->68|PF01883|7e-09|49.1|55/76|DUF59| RP:PFM:REP 127->162|PF03811|1e-05|47.1|34/82|Ins_element1| HM:PFM:NREP 2 HM:PFM:REP 10->68|PF01883|1.2e-17|41.4|58/76|DUF59| HM:PFM:REP 127->161|PF03811|0.00027|41.2|34/88|Ins_element1| GO:PFM:NREP 1 GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF03811|IPR003220| RP:SCP:NREP 1 RP:SCP:REP 8->98|1uwdA|5e-19|24.4|90/102|d.52.8.2| HM:SCP:REP 1->99|1uwdA_|2.7e-19|34.7|98/0|d.52.8.2|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 152 OP:NHOMOORG 140 OP:PATTERN -------------------------------------------------------------------1 ----1--1--1---1---------------------11111------1----111111--111-111111------------1----------------1-----1-----------------------------------------------------------------------------22222---1------------------1--------11--1-------1-----------------------------------------------------------------------------------------------------------------------1---------------------1-------------1111--11111-----------------2------------1---11-1---111-----11--------1---------------------------------------1--111111111112111211111111111112221--11111---1---11-------------------211------------------------11-1-----------------------------------------1------------------1--------------------1---1---11--111---1-1-----1--1111---------------------1--------------------------------------1---------------11111-----------11---1111----------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 53.9 SQ:SECSTR #######HHHHTTcEETTTTEcETTTTTcEEEEEEETTTTEEEEEcccccccccccHHHHHHHHHHHTTTccEEEEEEcccccccGGGccHHHHHHH###################################################################### DISOP:02AL 108-119| PSIPRED cccHHHHHHHHHHccccccccccEEEccEEEEEEEccccEEEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEEEEccccHHHccHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHccHHHHHccc //