[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57013.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 30->111 Y1300_MYCBO 5e-07 39.5 %
:TM
:REPEAT 2|6->66|78->136

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57013.1 GT:GENE BAD57013.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2337574..2337990) GB:FROM 2337574 GB:TO 2337990 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57013.1 LENGTH 138 SQ:AASEQ MFLSGRTVLGLIAGSAITVLGAGTALAAEDYYGSLALGLEPGAIIVGSGVNYPDQEGADVRALQECGVDNCSIVVQFRNACGAVAVRGNEVAWAGGYTRVEAEQSALAELGPDPSPLLVSLGSATPDRAHILASECAG GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 30->111|Y1300_MYCBO|5e-07|39.5|76/124| TM:NTM 2 TM:REGION 3->25| TM:REGION 32->53| NREPEAT 1 REPEAT 2|6->66|78->136| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cEEccHHHHHHHHccEEEEEEEcccccHHHHHcEEEEccccccEEEccccccccHHHHHHHHHHHccccccHHHHEEHHcccEEEEcccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEccc //