[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57015.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:270 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->269 PF06182 * DUF990 3.6e-41 31.6 231/233  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57015.1 GT:GENE BAD57015.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2339143..2339955) GB:FROM 2339143 GB:TO 2339955 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57015.1 LENGTH 270 SQ:AASEQ MGELRRRAAPYLAVLGSRVRAQRSYRLSFAADLFGALLVGVVEFAEVWVIFHNVGVLGGLDLDAALLLFGLSNSAFALAEVMFGHLDRLPRLIRMGTLDAYHLRPQPLLLQVITGDISLRRFARASVALVVLAVGLVRNDIDWSFGAAALLVVSLVSGIALFAGLFVAAAGCQFHLVDGAELTNSFTYGGSFAAAQPASVFPTPLKLVFGFAIPVAFTAYLPTIAVLELPGPALLPSWLAWLAPVAALWVWAVALGLWRTGTRHYQGGGG GT:EXON 1|1-270:0| TM:NTM 6 TM:REGION 32->54| TM:REGION 65->87| TM:REGION 122->144| TM:REGION 151->173| TM:REGION 204->226| TM:REGION 236->258| SEG 54->71|vgvlggldldaalllfgl| SEG 119->138|lrrfarasvalvvlavglvr| SEG 160->171|alfaglfvaaag| SEG 229->258|lpgpallpswlawlapvaalwvwavalglw| HM:PFM:NREP 1 HM:PFM:REP 34->269|PF06182|3.6e-41|31.6|231/233|DUF990| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----1-1111-----1-----------1--111-----------------------------------------------------------------------------------------------------------------1-1----------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 268-270| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //