[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57016.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:271 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   76->231 PF06182 * DUF990 5e-13 31.1 %
:HMM:PFM   54->271 PF06182 * DUF990 7.7e-21 22.5 209/233  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57016.1 GT:GENE BAD57016.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2339948..2340763) GB:FROM 2339948 GB:TO 2340763 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57016.1 LENGTH 271 SQ:AASEQ MVTLPGAFAVYGRLVVAGFRRQWQYKLAMFAGLFTNSVFGLVRGAVLGAAVGSAGAFAGYDAGSVGAYVWISQGLLGAITFMNVDSELAERVRTGDIAIDFLRPVDIQLAYLAEDLGRAACTLLPRALPSVLLGVVVFDITMPTTPGSYLLGVVSVLLAVAISFLGLFAVTMIGFRVVETRGFRTVYQIVGTFLAGLFVPVHLFPEWLRTVANATPFPAMLQAPVDVLSGRVVGLDAVQVVGTQVCWVVVVGGVGRVLLAAGRRRLEVQGG GT:EXON 1|1-271:0| TM:NTM 7 TM:REGION 1->19| TM:REGION 30->52| TM:REGION 119->141| TM:REGION 152->174| TM:REGION 184->206| TM:REGION 217->239| TM:REGION 241->262| SEG 38->59|vfglvrgavlgaavgsagafag| SEG 147->161|gsyllgvvsvllava| SEG 237->268|avqvvgtqvcwvvvvggvgrvllaagrrrlev| RP:PFM:NREP 1 RP:PFM:REP 76->231|PF06182|5e-13|31.1|151/234|DUF990| HM:PFM:NREP 1 HM:PFM:REP 54->271|PF06182|7.7e-21|22.5|209/233|DUF990| OP:NHOMO 28 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1----1-1111-----1-----------1--111---------------------------------------------------------------------1-------------------------------------------1-1------1-------------------------------1------13-----------------------------------------------------------------------------------------------------------------3----1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcc //