[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57018.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:266 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57018.1 GT:GENE BAD57018.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2342556..2343356 GB:FROM 2342556 GB:TO 2343356 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57018.1 LENGTH 266 SQ:AASEQ MGKRGTGKHRAASTSRQRVGVMVVAGAAPVVLTLAGNGVAAAAPEPPAETATWPSAEAPNVRPYHGIRIPDDTLTSLQWARPVPSPDYLSPVEALHPPVPVAPVPPIAPPPGVLRFGDVQVESPEWLPREQAIQLNDAAATKEAELATFLDSVGMERTRSDRVASQTIGAAAVGAAAGAVVASPFAVIGAGAGGALGLAIGLPFAPIGLAAAPVGAAYGAALMTVPLAVIGAGIGAGLGATQALTAPPRALGPAPDASQPPTAAAG GT:EXON 1|1-266:0| TM:NTM 4 TM:REGION 21->43| TM:REGION 166->188| TM:REGION 192->214| TM:REGION 218->240| SEG 19->31|vgvmvvagaapvv| SEG 40->59|aaaapeppaetatwpsaeap| SEG 91->113|pvealhppvpvapvppiapppgv| SEG 169->182|gaaavgaaagavva| SEG 184->222|pfavigagaggalglaiglpfapiglaaapvgaaygaal| SEG 230->246|igagigaglgatqalta| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 49-50, 255-266| PSIPRED cccccccHHHHHHHHHHHEEEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHcccccccccccccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHcccccHHcccccccccccccccc //