[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57024.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->120 2genA PDBj 6e-10 31.4 %
:RPS:PDB   19->190 3dcfB PDBj 1e-13 17.1 %
:RPS:SCOP  19->78 1t33A1  a.4.1.9 * 2e-12 38.3 %
:HMM:SCOP  4->91 1t33A1 a.4.1.9 * 6.1e-17 33.0 %
:HMM:SCOP  85->196 2genA2 a.121.1.1 * 7.6e-21 25.0 %
:HMM:PFM   20->64 PF00440 * TetR_N 2e-16 48.9 45/47  
:BLT:SWISS 28->190 Y472_MYCTU 1e-05 30.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57024.1 GT:GENE BAD57024.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2349460..2350125 GB:FROM 2349460 GB:TO 2350125 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57024.1 LENGTH 221 SQ:AASEQ MTSTPAARSAESAEARREQILAAARAVIEEHGPAALTGQIADRAGLARPNVYRHFASKEQLDLAVARSAYRELRAAIRARIDLSGTPIEVIRAPVAAQVMWADEHPNLYRFLISRGHQQAARQRGDRGAFAAELAAAGARFLPRFGEDRAAAEAVLVGIIGLVDASVVHWLDRRHCSRTDLIDTLTTQAWLVIDHRLRAMGEHLDPHAPLTQAPRSGISTP GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 28->190|Y472_MYCTU|1e-05|30.1|163/234| SEG 6->18|aarsaesaearre| SEG 127->142|rgafaaelaaagarfl| BL:PDB:NREP 1 BL:PDB:REP 19->120|2genA|6e-10|31.4|102/186| RP:PDB:NREP 1 RP:PDB:REP 19->190|3dcfB|1e-13|17.1|170/181| HM:PFM:NREP 1 HM:PFM:REP 20->64|PF00440|2e-16|48.9|45/47|TetR_N| RP:SCP:NREP 1 RP:SCP:REP 19->78|1t33A1|2e-12|38.3|60/88|a.4.1.9| HM:SCP:REP 4->91|1t33A1|6.1e-17|33.0|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 85->196|2genA2|7.6e-21|25.0|112/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 33 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- --------------21111-12111211111-1111321---1---------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 89.1 SQ:SECSTR ##################HHHHHHHHHHHHTcTTTccHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHTHHHHccTTccccHHHHHHHHHHHHHHHHHGccccHHHHTHHHHHcccHHH###### DISOP:02AL 1-19, 212-221| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //