[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57027.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57027.1 GT:GENE BAD57027.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2351576..2351770 GB:FROM 2351576 GB:TO 2351770 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57027.1 LENGTH 64 SQ:AASEQ MRYPCGSSSGTTLSSPLSSRATRTVDQPATTSPAAERTRRNSRPRGHTRVAPRPGAPFSTTPTG GT:EXON 1|1-64:0| SEG 6->19|gsssgttlssplss| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14, 30-49, 58-64| PSIPRED cccccccccccccccccccHHccccccccccccHHHHHHHcccccccccccccccccccccccc //