[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57028.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  182/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:109 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->105 3f6vA PDBj 2e-13 38.3 %
:RPS:PDB   17->98 1bibA PDBj 8e-15 17.1 %
:RPS:SCOP  1->87 1fnnA1  a.4.5.11 * 5e-12 11.5 %
:HMM:SCOP  6->99 1ulyA_ a.4.5.58 * 2.6e-25 35.1 %
:RPS:PFM   16->62 PF01022 * HTH_5 4e-07 48.9 %
:HMM:PFM   17->61 PF01022 * HTH_5 1.1e-16 46.7 45/47  
:BLT:SWISS 9->88 SDPR_BACSU 8e-10 30.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57028.1 GT:GENE BAD57028.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 2351902..2352231 GB:FROM 2351902 GB:TO 2352231 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD57028.1 LENGTH 109 SQ:AASEQ MARAATTTDVFNAVAEPRRREILDVLLDGERPVNDLVRMLGVPQPQVSKHLRVLREVGVVHVRDDGRQRMYRLNRRALAPIHEWVRRYERAWSERFDQLDAVLAETETT GT:EXON 1|1-109:0| BL:SWS:NREP 1 BL:SWS:REP 9->88|SDPR_BACSU|8e-10|30.0|80/90| BL:PDB:NREP 1 BL:PDB:REP 9->105|3f6vA|2e-13|38.3|94/96| RP:PDB:NREP 1 RP:PDB:REP 17->98|1bibA|8e-15|17.1|82/294| RP:PFM:NREP 1 RP:PFM:REP 16->62|PF01022|4e-07|48.9|47/47|HTH_5| HM:PFM:NREP 1 HM:PFM:REP 17->61|PF01022|1.1e-16|46.7|45/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01022|IPR001845| GO:PFM GO:0005622|"GO:intracellular"|PF01022|IPR001845| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01022|IPR001845| RP:SCP:NREP 1 RP:SCP:REP 1->87|1fnnA1|5e-12|11.5|87/103|a.4.5.11| HM:SCP:REP 6->99|1ulyA_|2.6e-25|35.1|94/0|a.4.5.58|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 384 OP:NHOMOORG 182 OP:PATTERN -------------------------------------------------------------------- 236-2---------41111-12--2211111123636368-1-2-911-1113311-4--521-4-4--1--------------------------1----2--1225-4----------------------------------1-1--------111----1---1--1-11111-1--1--1-------1--11111111-1111111311--112---2-11------34-------------------------------------------------------------------------------------------------------------------------1------------------5--3--2-----215421-1---------------3---1----1786-444175266556--222131------1-----------------------------------------------112--2221111211-----11--------31--112--112-----1-1-1--1--------------1-----1----------------1-----1213156-1-----------------------------------------------------------------------------------------------------------------------------------2------------------------------------1-------------------------------------1--------------------------------11----------------332211-----------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 100.0 SQ:SECSTR GGGHHHHHHHHHccccHHHHHHHHHHTTccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccHHHHHHTcccccEEEccEEEcccccccccc DISOP:02AL 1-3, 107-109| PSIPRED cccHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //