[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57029.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.96.1
:197 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  25->102 1ornA  a.96.1.1 * 3e-04 21.6 %
:HMM:PFM   133->188 PF07583 * PSCyt2 1.6e-05 40.0 50/209  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57029.1 GT:GENE BAD57029.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2352296..2352889) GB:FROM 2352296 GB:TO 2352889 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57029.1 LENGTH 197 SQ:AASEQ MRPAIGAALIRCGECGGYEYGGAPGCRRCAALVDDLVEEKWRRWRADRAGEPEHELARRVADEPDRHDWRVVDAALDRLGCTECGDRLGRGPATCAACTLAHGYRYAAVETDRPGVPPGNEHAVRVNVSVVRRPAATSPQELLIRRLLLPALLIGLLPTTAQAQRLSAAAKADPSPERVTALVDAWLTAAGVPLPAP GT:EXON 1|1-197:0| SEG 12->22|cgecggyeygg| SEG 142->172|llirrlllpalligllpttaqaqrlsaaaka| HM:PFM:NREP 1 HM:PFM:REP 133->188|PF07583|1.6e-05|40.0|50/209|PSCyt2| RP:SCP:NREP 1 RP:SCP:REP 25->102|1ornA|3e-04|21.6|74/214|a.96.1.1| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1-----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 165-175, 196-197| PSIPRED cccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHccEEEEEEccccccccccccEEEEEHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccc //