[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57038.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:HMM:PFM   15->47 PF02406 * MmoB_DmpM 1.8e-05 27.3 33/87  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57038.1 GT:GENE BAD57038.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2362404..2362649) GB:FROM 2362404 GB:TO 2362649 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57038.1 LENGTH 81 SQ:AASEQ MTALFVLDVPENKPVAEVAGRDPAVSVDRVGPYFKISAPGPIRVDRRATGCRHAVWYSSVAGLIDSRIVQWDKDALEVRPR GT:EXON 1|1-81:0| HM:PFM:NREP 1 HM:PFM:REP 15->47|PF02406|1.8e-05|27.3|33/87|MmoB_DmpM| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEcccccHHHHHHHcccccEEEEccccEEEEcccccEEEccHHcccHHHHHHHHHHHHccccEEEEEEEEEEEccc //