[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD57048.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.19.1
:317 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  165->268 1cjyA2  c.19.1.2 * 6e-07 7.8 %
:HMM:SCOP  1->222 1oxwA_ c.19.1.3 * 1.4e-17 35.2 %
:RPS:PFM   166->205 PF01734 * Patatin 7e-05 54.1 %
:HMM:PFM   7->209 PF01734 * Patatin 5.3e-12 29.8 178/204  
:BLT:SWISS 170->275 Y2594_MYCBO 4e-06 28.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD57048.1 GT:GENE BAD57048.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(2375106..2376059) GB:FROM 2375106 GB:TO 2376059 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD57048.1 LENGTH 317 SQ:AASEQ MTTRRALAIGCGGTLGFAWTVVALRAVEQALDWDARTAEVLLGTSAGAELVAALGAGRTPLDLLAALDGTPDADPMLLRHFAFHPGALPPLPAPALPGLGLIRGARRAGSPYGALAGLLPRGRGDAGWLREYGAALAGPDGWVTHPDTWLVAVDTATGARTAFGSPDAPRAELGAAIAASWAIPGWFPPVRIGGRDYLDGGALSSVSADLLACRDLDEVVVIAPMTSANGAPARGVDRLERLLRAPMTRGLDAEIARLRAAGIRVIRVEPAAADLAAMGPNFMDVTRRPATLAAARRTTPGLVADAILAADRAGAAA GT:EXON 1|1-317:0| BL:SWS:NREP 1 BL:SWS:REP 170->275|Y2594_MYCBO|4e-06|28.8|104/583| SEG 46->57|agaelvaalgag| SEG 85->109|pgalpplpapalpglglirgarrag| SEG 113->127|galagllprgrgdag| SEG 286->300|trrpatlaaarrttp| SEG 304->316|adailaadragaa| RP:PFM:NREP 1 RP:PFM:REP 166->205|PF01734|7e-05|54.1|37/182|Patatin| HM:PFM:NREP 1 HM:PFM:REP 7->209|PF01734|5.3e-12|29.8|178/204|Patatin| GO:PFM:NREP 1 GO:PFM GO:0006629|"GO:lipid metabolic process"|PF01734|IPR002641| RP:SCP:NREP 1 RP:SCP:REP 165->268|1cjyA2|6e-07|7.8|103/504|c.19.1.2| HM:SCP:REP 1->222|1oxwA_|1.4e-17|35.2|179/0|c.19.1.3|1/1|FabD/lysophospholipase-like| OP:NHOMO 20 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1111-112-----11-----------------1-1-----------------------------------------------------------------111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 316-317| PSIPRED ccccEEEEEcccHHHHHHHHHHHHHHHHHHcccccccccEEEEccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccEEEEEEEcccccEEEEcccccccccHHHHHHHHHcHHHccccEEEccEEEEccEEEccccHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //